Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G146614-GRMZM2G421946
Species:maize
Duplication type:WGD
Function (paralog1):B-box zinc finger family protein
Function (paralog2):hypothetical protein LOC100280141 (LOC100280141), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.7701944452536
Log2 mRNA fold difference:-2.7131821996087
Log2 TE fold difference:1.0395921053661
Sequences
Protein sequence

MGAARDSAAAGQKHGTGTRCELCGGAAAVHCAADSAFLCLRCDAKVHGANFLASRHVRRR
LVPRRAADPEASSAASSGSSCVSTADSAESAATAPAPCPSRTAGRRAPARARRPRAEAVL
EGWAKRMGFAAGPARRRAAAAAAALRALGRGVAAARVPLRVGMAGALWSEVAAGCRGNGG
EEASLLQRLEAAAHVPARLVLTAASWMARRPDARQEDHEEGWAECS*

MGAAGDAAAAGTRTRCELCGSAAAVHCAADSAFLCPRCDAKVHGANFLASRHVRRRLPRG
GAESGASSSSGSCLSTADSAQSRAAPPPPGRGRRAEDVLEGGWARRKRVAAGPACRRRVP
LRVAMAAARWSEVRAGGGAEAAVLAVAAWWMTRAARARPPAAGAPDLEEGWAECSPEFVV
RQGPHPSAM*

Other information
Ka divergence:0.185377KaKs divergence:-0.333841
GC content 1 (%):79GC content 2 (%):76GC content divergence:-0.019
Length 1 (bp):681Length 2 (bp):570Length divergence:-0.089
MFE 1 (kcal):-448.71MFE 2 (kcal):-346.7MFE divergence-0.128