Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G146670-GRMZM2G150616
Species:maize
Duplication type:WGD
Function (paralog1):voltage-dependent anion channel protein 1b
Function (paralog2):voltage-dependent anion channel protein 1a

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.8533856349641
Log2 mRNA fold difference:0.53179442881668
Log2 TE fold difference:1.2927892659717
Sequences
Protein sequence

MVGPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYSSNGVAVTATSTKKADLIFSEIHSQIK
NKNMTVDVKANSESNIITTVTVNEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNAS
VSLTANPVANLSAAFGTKALAVGAEISFDSATGNFTKYNAGLMFTHEDLIASLNMNNKGD
NLTGAYYHKVSELTNTAVGAELTHSFSTNENTLTFGGQHTLDPLTVLKARINNSGKASVL
IQHEWRPKSLVTISAEVDTKTIEKSSKVGIAVALKP*

MVGPGLYTEIGKKTRDLLYKDYQTDHKFTLTTYTSNGVAVTASSTKKADLILGEIQSQIK
NKNMTIDVKANSESNIITTITVDEIATPGLKTILSFAVPDQRSGKVELQYLHDYAGVNAS
IGLTANPVVNLSAAFGTKAVAVGADISLDTATGNLTKYNAALRFTHEDLVASLNLNNKGD
SLTGAYYHKVSELTNTAVGAELTHSFSTNENTLTFGGQHALDPLTVLKARINNSGKASAL
IQHEWRPKSLVTISAEVDTKTIEKSSKVGIAVALKP*

Other information
Ka divergence:-0.247188KaKs divergence:-0.593631
GC content 1 (%):48GC content 2 (%):50GC content divergence:0.02
Length 1 (bp):831Length 2 (bp):831Length divergence:0
MFE 1 (kcal):-241.9MFE 2 (kcal):-267.01MFE divergence0.049