Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G146818-GRMZM2G087165
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276267
Function (paralog2):hypothetical protein LOC100303826

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAIGSLIASTFARSSHALPAAAASAISQAPRSQHTASPLLSGLGAAARAFSSRALWKGAF
VDAFLSRIKKNRENMNGKKIWSRRSSILPEFVGSSVLIYNGKTHVRCKITEGKVGHKFGE
FAFTRRRRPHRTMTGKGNQGKARK*

MPIGSLFVSRLARSSHALPAAAAAAISQAPRPQHIASPIFSGLGAAARDFSSRALWKGAF
VDAFLARIKKNRENMNGKKIWSRRSSILPEFVGSTVLIYNGKSHVRCKITEGKVGHKFGE
FAFTRRRRPHRTITGKGNQGKGRK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):51GC content divergence:0.02
Length 1 (bp):435Length 2 (bp):435Length divergence:0
MFE 1 (kcal):-137.4MFE 2 (kcal):-139.9MFE divergence0.009