Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G147014-GRMZM2G373522
Species:maize
Duplication type:WGD
Function (paralog1):dehydrin COR410
Function (paralog2):dehydrin

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.4031512146404
Log2 mRNA fold difference:2.4390032316739
Log2 TE fold difference:-1.0212057183636
Sequences
Protein sequence

MEDERNTQQHQGGEAQQDAADQVDVKDRGLLDSLLGRKKHDDDQEKKKQTDELATGMEKV
TVSEPEKHGHKEEEHEVVGEKKEGLLAKLHRTSSSSSSSSDEEEEAIDENGEIIKRKKKK
MGLKEKLKEKLPGHKDGHHTAAPSPAPAPVETHAHHQEEAHRPHVVPTPAPPPPPHVHQH
DHGVVVQDDVKTGTPPHAPEEEKKGLLDKIKEKLPGGHNKKPEAAAAAAPAPPVHAPAPA
PQAENVSSPDGKEKKGLLGKIMDKIPGYHKSSAEEADHKADAAGEHRTSS*

MEDERNTQQHQGGEQAQDQENEVKDRGLLDSLLGRNKHDDQEKKNQQEEEELATGMEKVT
VAEPDHKEEGHEAAEKKDSLLAKLHRTSSSSSSSSDDEEEEVIDENGEIVKRKKKGLKEK
VKEKLAAHKAHDEGDHHQPGVPAPAPAPPVAVDTHAHHQEGEHKPHFPAPAPPPHVETHH
PVVVHKIEDDDTKTQTPPQAPEEEKKGLLDKIKEKLPGGHKKPEDAAAAAAAPAVHAPPP
PAPHAEVDVSSPDGKKGLLGKIMDKIPGYHKSSGEEDRKDAAGEHKTSS*

Other information
Ka divergence:0.113245KaKs divergence:-0.507019
GC content 1 (%):65GC content 2 (%):65GC content divergence:0
Length 1 (bp):873Length 2 (bp):870Length divergence:-0.002
MFE 1 (kcal):-358.13MFE 2 (kcal):-350.99MFE divergence-0.01