Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G147243-GRMZM2G035465
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191581
Function (paralog2):hypothetical protein LOC100274569

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSPPLDLDYIGLSPAAAAAAAHDDLKGTELRLGLPGSGSPDRRVVAATATTLDLLPAKGA
KRGFSDEAPTPSPGAASGKGKKVAEEEDDKKVAATPQPVAKAQVVGWPPIRSYRKNTMST
TQLKGSKEDAEAKQDQGFLYVKVSMDGAPYLRKIDLKTYKNYKDLSTALEKMFSGFSTGK
DGLSEYRKDGEYVLTYEDKDGDWMLVGDVPWEMFADSCRRLRIMKGSDAIGLAPRAADKS
KNRN*

MSPPLELDYIGLSPPAAAAAAENDELKGTELRLGLPGSGSPDRRVVAATATTLDLLPAKG
AKRGFSDEAPPPSPVATAGKGKKVAEEEYDEKKVAATPQPAAKAQVVGWPPVCNYRKNTM
TTTQLEGSKEDGDAKQGQGFLYVKVSMDGAPYLRKIDLKTYKNYKDLSTALEKMFSGFST
GKDGSSEYRKDGEYVLTYEDKDGDWMLVGDVPWDCHIVFRSNCRMFAGSCRRLRIMKGSD
AIGLAPRAADKSKNRN*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):60GC content divergence:0.008
Length 1 (bp):735Length 2 (bp):771Length divergence:0.024
MFE 1 (kcal):-286.5MFE 2 (kcal):-306.7MFE divergence0.034