Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G147256-GRMZM2G147268
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100272842
Function (paralog2):hypothetical protein LOC100274124

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.21011161996436
Log2 mRNA fold difference:-1.7547314652493
Log2 TE fold difference:1.9732515910294
Sequences
Protein sequence

MASKVVDLRSDTVTKPSEAMRAAMAAADVDDDVLGADPTAHRFEAEMAAVMGKEAALFVP
SGTMGNLISVLVHCDVRGSEAILGDNSHIHVYENGGISTIGGVHPRTVKNNPDGTMDIDK
IVAAIRHPDLHYPTTRLICLENTHGNTGGKCLSVEYTDKVGEIAKSHGLKLHIDGARIFN
ASVALGVPVDRLVKAADSVSVCLSKGLGAPVGSVIVGSKAFIDKARILRKTLGGGMRQVG
VLCAAAHVAVRDTVGKLADDHRKAKALAEGLKKIEQITVDSASVETNMVFFEVMDPRISP
DKLCQVLEQDNVLALPANSKSIRFVIHYQISDADVGYALACVEKAIKELLEGSTELGHSI
NGATKSSYGH*

MVTNVVDLRSDTVTKPSDAMRAAMAAADVDDDVLGADPTARRFEAEMAALLGKEAALFVP
SGTMANLVSVLAHCDVRGSEVILGDASHIHVYENGGISTLGGVHPRTVPNNPDGTMDLAR
IVDAIRNPDGALLYPTTRLICLENTHANSGGKCLSVEYTDKVGEIAVNHGLKLHIDGARI
FNASVALGVPVHRLVKAADSVSVCLSKGLGAPIGSVVVGSEAFIDKARILRKTLGGGMRQ
VGVLCAAAYVAVRDTVGKLADDHRKAKALAEGLKKIKQLTVDSSSVETNMVFFDIVDPRI
SPSKLCQVLEQRNVLAMPASSKSVRFVIHYQISDSDVQYALTCVEKAVEELLKGGTKLEH
LTNGTAKNSYWH*

Other information
Ka divergence:-0.316968KaKs divergence:-0.155358
GC content 1 (%):54GC content 2 (%):56GC content divergence:0.018
Length 1 (bp):1113Length 2 (bp):1119Length divergence:0.003
MFE 1 (kcal):-420.64MFE 2 (kcal):-456.21MFE divergence0.041