Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G147849-GRMZM2G110735
Species:maize
Duplication type:WGD
Function (paralog1):endo-1,4-beta-glucanase Cel1
Function (paralog2):hypothetical protein LOC100274698

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MFGRDPWGGPLEISNADSATDDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKKKRY
VDLGCVVVDRKVFMWTVGTILGLGVFIGFVIMIVKLVPHKRPPPPPPDQYTQALHKALMF
FNAQRSGPLPKHNGVSWRGNSCMKDGLSDSTVRRSLVGGFYDAGDAIKFNYPMAWSMTML
SWSVIEYRAKYEAIGELDHIRELIKWGTDYILKTFNSSADTIDRIVAQVGVGDTSKGSSQ
PNDHYCWMRPEDIDYKRPVTECHSCSDLASEMAAALAAASIVFKNSKTYSDKLVKGAKAL
YKFGRLQRGRYSPNGSDQAIFYNSTSYWDEFVWGGAWMYFATGNNSYLTVATAPGMAKHA
GAYWFGSPNYGVFTWDDKLPGAQVLLSRLRLFLSPGYPYEEILRTFHNQTDNVMCSYLPV
FNSFNFTKGGLIQLNHGRPQPLQYAVNAAFLASLYSDYLEAADTPGWYCGPNFYTIEVLR
KFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKA
NPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNT
IFSAIPPMFPTPPPPPSAWKP*

MFGRDPWGGPLEISNADSATDDDRSRDLDRAALMRQLDETQQSWLLAGPGDQAGKKKKRY
VDLGCVVVDRKIFMWTVGTILGLGVFIGFIMMIVKLVPHKRPPPPPPDQYTQALHKALMF
FNAQRSGPLPKHNGVSWRGNSCMKDGLSDSTVRRSLVGGFYDAGDAIKFNYPMAWSMTML
SWSVIEYRAKYEAIGELDHIKELIKWGTDYILKTFNSSADTIDRIVAQVGVGDTSKGSSQ
PNDHYCWMRPEDIDYKRPVTECHSCSDLASEMAAALAAASIVFKDSKTYSDKLVKGAKAL
YKFGRLQRGRYSPNGSDQAIFYNSTSYWDEFVWGGAWMYFATGNNSYLTVATAPGMAKHA
GAYWFGSPNYGVFTWDDKLPGAQVLLSRLRLFLSPGYPYEEILRTFHNQTDNVMCSYLPL
FNSFNFTKGGLIQLNHGRPQPLQYAVNAAFLASLYSDYLEAADTPGWYCGPNFYTTEVLR
KFARSQLDYILGKNPLKMSYVVGFGNKYPKRPHHRGASIPHNGVKYGCKGGYKWRDTKKA
NPNILVGAMVAGPDRRDGYKDVRTNYNYTEPTLAANAGLVAALISISDIKTGRFGIDKNT
IFSAIPPMFPTPPPPPSAWKP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):57GC content 2 (%):56GC content divergence:-0.009
Length 1 (bp):1866Length 2 (bp):1866Length divergence:0
MFE 1 (kcal):-722.37MFE 2 (kcal):-704.73MFE divergence-0.012