Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G148115-GRMZM5G897988
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273270
Function (paralog2):LOC100283523

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.072484412579158
Log2 mRNA fold difference:0.14739723658938
Log2 TE fold difference:-0.081645718066184
Sequences
Protein sequence

MEAASNGGLLYHEVQEGKLCAVHCVNTTLQGPFFSEFDLAALAADLDQRERLVMLEGSRS
PGADNATAGDFFAEGEGSHNVSLGGDFSIQVLQKALEVWDLQVIPLDSPAAGSSQFDPEQ
EVAFICHLQDHWFCIRKVNGEWYNFNSLYPAPEHLSKFYLSAFIDTLKGSGWSIFAVRGN
FPKECPMATEGSNGFGQWLTPDDARRITASCNQVQAPTQQVQPPLLGDRSGGMSEMDMIV
AQQEEADLNAAIAASLMDTGGPFASYDADQEYSNSQDAPAAGPARSKEEADKSEPSAPPC
EEETQELASGSDTKREVSSVEEKGTAREE*

MEAASNGGLLYHEVQEGKLCAVHCVNTALQGPFFSEFDLAALAADLDQRERLVMLEGSRS
PGAGNAAAGDFFAEGEGSHNVSLGGDFSIQVLQKALEVWDLQVIPLDSPAAGSSLFDPEQ
EVAFICHLQDHWFCMRKVNGEWYNFNSLYPAPEHLSKFYLSAFIDTLKGSGWSIFAVRGN
FPKECPMATEGSNGFGQWFTPDDARRITASCNQVQTPPTEQVQSPLLAEQPEGMSEMDMI
AAQQEEADLNAAIAASLMDTGVPFASYAAAREHSDSQDSPAREAAPSKDNNQEEAGKAEP
SAPPCEEDIQELASGSDTRREVPSVEEKGSAKEE*

Other information
Ka divergence:0.0206031KaKs divergence:-0.0172998
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):990Length 2 (bp):1005Length divergence:0.008
MFE 1 (kcal):-410.21MFE 2 (kcal):-401.71MFE divergence-0.01