Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G148213-GRMZM2G172210
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191618
Function (paralog2):hypothetical protein LOC100272403

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.7128649133646
Log2 mRNA fold difference:2.4482974525809
Log2 TE fold difference:-0.74134073733224
Sequences
Protein sequence

MGAGRVCRGGPSSASPAAGRPFSTLAASSSASPSSAPSETASTSVTKTVNGSHHFKIAGY
SLSKGIGVGKFIASESFNVGGFDWAIYFYPDGKSAEDGAAYVSLFIALASEGTDVRALFE
LTLVDQSGKGQDKVHTHFGRSLESGPYTLKYRGSMWGYKRFFKRTALETSDYLKDDCLLV
NCTVGVVQSHTEGPKIYTIPVPRSNMALHIGQLLTSGKRTDIAFEVDGEMFPAHKVILSA
RSPVFRAQLFGPMKDKDMKCIKIEDMEAPVFKALLHFMYWDELPDIEELTGVNTTWVSTL
MAQHLLAAADRYALERLKLLCELKLCEDVAINTVANTLALAEQHHCYQLKTVCLKFVALP
ENLKAVMQTDGFDYLQQSCPSLLTELLEYVAKAGEHSVSPCLYSTEVLDGGDANGRRVKP
RI*

MGAGRVCRGGPFSASPAAGAAAGRPFPPLTASSSSSPSSAPSETASTSVTKTVNGSHHFK
IAGYSLSKGIGVGKFIASESFNVGGFDWAIYFYPDGKSGEDGAAYVSLFIALASEGTDVR
ALFELTLVDQSGKGQDKVHTHFGRSLESGPYTLKYRGSMWGYKRFFKRVALETSDYLKDD
CLLVNCTVGVVQSHTEGPKIYTIPVPRSNMALHIGQLLTSGKRTDIAFEVDGEMFPAHKV
ILSARSPVFRAQLFGPMKDKDMKCIKIEDMEAPVFKALLHFMYWDELPDLEELTGVNTTW
VSTLMAQHLLAAADRYALERLKLLCELKLCEDVAINTVANTLALAEQHHCYQLKTVCLKF
VALPENLKAVMQTDGFDYLQQSCPSLLTELLEYVAKIGEHSVSPCLYSTEVLDGGDANGR
RVKPRI*

Other information
Ka divergence:0.174172KaKs divergence:0.21453
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):1269Length 2 (bp):1281Length divergence:0.005
MFE 1 (kcal):-467.5MFE 2 (kcal):-472.47MFE divergence0.005