Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G148323-GRMZM2G104254
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEVEPARRDAAALDPELLQLAELAPGALRENSIADALYSQWLVLPETTKLVKSLIDDAKT
GAVLNVAGSSASTNAASSSSLPSMFPAGSAPPLSPRSTSGSPRVMRRGSGAGPSSLGSPL
KLVSEPVREVIPQFYFKNGRPPTKDLKEQCLSRTDHLFFGGGGLQVQEFRSVTKDICKLP
SFLSSVLFKKIDVECTRTVSRDAFVEYWINDNKVTMDMASQIFEILRKPGYTYLTQDDFK
PVLKELLATHPGLEFLQGTPEFQERYAETVIYRIFYSINRSGNGHLTLRELKRGNLIAAL
QQLDEEEDINKVLRYFSYEHFYVIYCKFWELDADHDFLIDKENLIKYGNHSLTYRIVDRI
FAQIPRKFTSMTEGKMGYEDFVYFILSEEDKSSEPSLEYWFKCIDLDGNGILTFNEMQFF
YEEQLHRMECMAQEPVLFLDILCQMIDMIGPENESYLTLRDLKRCKLSGNIFNILFNLNK
FMAFETRDPFLIRQERENPTLTEWDRFAHREYIRLSMEEDGEDASNGSGDVWDESLEAPF
*

MDDNKITMDMASQIFEILRKPGCTYLTQDDFKPVLKELLATHPGLEFLQGTPEFQERYAE
TVIYRIFYSINRSGNGHLTLRELKRGNLIAALQQLDEEEDINKVLRYFSYEHFYVIYCKF
WELDADHDFLIDKENLIKYGNHSLTYRIVDRIFTQIPRKFTSMTEGKMGYEDFVYFILSE
EDKSSEPSLEYWFKCIDLDGNGILTYNEMQFFYEEQLHRMECMAQEPVVFGDILCQMIDM
IGPENESYFTLRDLKRCKLSGNIFNILFNLNKFMAFETRDPFLIRQERENPTLTEWDRFA
HREYIRLSMEEDGEDASNGSGDVWDESLEAPF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):43GC content 2 (%):39GC content divergence:-0.049
Length 1 (bp):1623Length 2 (bp):999Length divergence:-0.238
MFE 1 (kcal):-504.26MFE 2 (kcal):-270.83MFE divergence-0.301