Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G148453-GRMZM2G020081
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):LOC100281433

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MFSRPIKTNLKVAESSAFLAYVKSSTPATSSFDSGLQRGDSRLDSLDNHGNCSSATDRSD
TGADVNIRNKEAFEMPVQYPMVCFSSSSMHMERSNEGHNDTSGTPPAYHFPFYYPGMVEH
NMALSSVQNFQANINSAQAHTPPAMLHQYNVFSQCHSLPMISPFQFNTSGMSMHSSHLPT
QNVWSSASSTPTPDETCNRSERRAAALAKFRQKRKERCFDKKVRYVNRKKLAETRLRVRG
QFVRHASNMDIISTGDDISEDEDDDPTSREVDMISSPE*

MAGGGEGDRVGVGGAQQFVDRSKVRILLCDGDATSSREVLRLLCNCSYHVTCAKSPRQVI
NILNYEGGEIDIILAEVDLPVSKCFKMLKYIARNKDLRHIPIIMMSNRDEVSVVVKCLRL
GAAEYLVKPLRTNELLNLWTHVWRRRRMLGLPEKNFFNDNFELVLSEPSDANTNSTTLLS
DETDDRPKGNTNQETGTSKQLEYESNPSVAEPDQREKMEGVPGSALDASKKSSPRRAFSR
PIKTNLRVAESSAFLAYVKPSTPATSSFDSELQRGGSRLDSLDNQGNCSSATDRSDTGTD
VNIRSKEAFEMPAQYPMVWFSSSNMHMERSSEGHNDTSGTPPAYHFPFYYPGMVEHNMAL
SSAQDFQANINNAQAHTPPAMLPQYNVYPQCHGLPVIPSFQFNPSGMSTHSSHLPTQNVW
SSASSTPPVPEETCSRSERRAAALAKFRLKRKERCFDKKVRYVNRKKLAETRPRVRGQFV
RQPTNTDVISIGDDISEDEDDDPSSREVDMVSSPE*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):43GC content 2 (%):51GC content divergence:0.085
Length 1 (bp):837Length 2 (bp):1548Length divergence:0.298
MFE 1 (kcal):-228.36MFE 2 (kcal):-523.22MFE divergence0.392