Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G148555-GRMZM2G374065
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.27470853203544
Log2 mRNA fold difference:0.46425415276059
Log2 TE fold difference:-0.18390601634877
Sequences
Protein sequence

MGSDLKEMKYRRRIGVEERPQCSDPRGGADWAALQQDPVELLRKLDELRDQITRSCNVVV
GQPREHRRVSRRAVSMLPEHLEPPPLPGYHRSRYGGRYGHGLPPPSPYAPPRPEHGERYA
RQSSGHYRQYPPRHCENGGMGPGTYHHHGCACPHCLHGQRTFPQEENIPMARYFAGQHES
YRLERSPSVSSDYDRGSVASSLYSHRSVSKMRAEYFRKKAEHICRPVDGAAPFSVCSSCY
KLLLMPMEKCVGRKQNRFQCGSCCQIISLKHQEENGIPFALAPSSSLHAPEMEQSTSDQM
RQDSVHQRHEDFNFMFNNSNDHCDMQNNMDFTDDNSLPSTASNDRIEIDKECGSTRSIQS
KAEGLSFSPSRSVDIGSPKDILCERDKDSNVEPSSDGPLSPRSPTLEDKLVDPLCAQEKG
NDEDDQGTAYRSNLTCKGEYDANDEYDGDVSTRSKPESNVNDKDTTEGETSCRNYKEDNC
CNIEDSSKTYEQNSGEDDTSSLVDGNEKYESMNTKDDDSSPGGEDTCNRYEPKVEDDENC
VLGAESISNNCDENNKDAIKTGSISERHEELIIEEENEKLQQAFIEDANSQAGSGSSINE
RTNSGFSRGSSEAGLDEDQSSTGKSGDSSFFAGFLKKGFKDLSLLNKSMDSVKVSINGHP
ISERALKKAEKKAGPVDPGSYWYDYRAGFWGVMGRECIGIVPPFIREFNYPMARNCAGGD
SGVFVNGRELHQRDLDLLVGRGLPRTSGKSYSLEMSGNVIDEDTGKKLRSLGKLAPTIEK
LKRGFGMHVPEEFR*

MGSDLKEMKYRRRIGAEERPQCSDRRGGAGWAALQQDPVELLRKLDELRDQIARSCNVVA
QRREPRRASRRAVSMLPAEHLEEPPPLPGYHRSRHGGRFGPGLPPPGPYAPPRPEHGERY
VRQSSGHYRQYPGRQWENGGMGPGSFHHYGCACPHCLHGQRTSPQEENIPMARYFARQHE
SYRFERSPSVSSDYDRRSVASSLYSHRSVSKRRAEYFRKKAEHICRPVDGAAPFSVCSSC
YKLLQMPTEKCIGRKQNRFQCGSCCQIVSLKHDEENGIPFAPSLSLYAPETEQSSSDQMR
RDTVHQHHEDFNSMFYNSNDHSNMQNNMDSTDDNSLSSTMSNDRIGKDCGSTRSIQSKAE
DLPFSPSRSVDNGSPKDILCERDTDCKVEPSVGGPVSPRSPALEDKLVDPLCAQEKCNDE
DDQGMAMAYKSDLTCKGEYDVNDQYDGGISTRSKQESNEDDKDATEDEISCRSYEQKSKE
DNSCNIEDSSKTYEQNSGEDDTSSLVNGSEKYQCMNIKDEDSSPGGEDTCNKYESKVKRD
ENYVLGAESIRKNCDENNADVMETGSISERHDGLKIEEDNEKLQQPFIEDANSQTGSGSS
VNERTNSGFSRGSSEAGLDEDQSSTGKSGDSSFFAGFLKKGFKDLSLLNKSMDNVKVSIN
GHPISEKALKKAEKKAGPVDPGTYWYDYHAGFWGVMGRECIGIVPPFIREFNYPMAKNCA
GGDTGVFVNGRELHQRDLDLLVGRGLPRTSGMSYSIEMSGNVIDEATGKKLRSLGKLAPT
IEKLKRGFGMHVPEEFR*

Other information
Ka divergence:-0.0461284KaKs divergence:-0.160949
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):2385Length 2 (bp):2394Length divergence:0.002
MFE 1 (kcal):-800.94MFE 2 (kcal):-817.77MFE divergence0.01