Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G148744-GRMZM2G702426
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272465
Function (paralog2):60S ribosomal protein L17

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.17826281751644
Log2 mRNA fold difference:-0.46135605705915
Log2 TE fold difference:0.6365386754253
Sequences
Protein sequence

MVKYSQEPGNPTKSAKAMGRDLRVHFKNTRETAFALRKLSLTKAKRYLEDVIAHKQAIPF
RRYCGGVGRTAQAKSRHSNGQGRWPVKSARFILDLLKNAESNADVKGLDVDNLYVSHIQV
NQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEADNIVAARKQ*

MVKYSQEPGNPTKSAKAMGRDLRVHFKNTRETAFALRKLPLTKAKRYLEDVIAHKQAIPF
RRYCGGVGRTAQAKSRHSNGQGRWPVKSARFILDLLKNAESNADVKGLDVDNLYVSHIQV
NQAQKQRRRTYRAHGRINPYMSSPCHIELILSEKEEPVKKEADNIVAARKQ*

www.000webhost.com

Other information
Ka divergence:1KaKs divergence:0.989691
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):516Length 2 (bp):516Length divergence:0
MFE 1 (kcal):-183.5MFE 2 (kcal):-176.3MFE divergence-0.02