Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G148831-GRMZM5G827174
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.4152831576728
Log2 mRNA fold difference:-1.153626760567
Log2 TE fold difference:-0.34585663270425
Sequences
Protein sequence

MDPCPFVRVLVGNLALKMPASAPPAAAAASGSGVHPATPPCYYCRIRLNKLPYQTAPAPL
LPATEEGSAPAPASCAAAFHASKADLDRAAARPALFLGGRLRTARLKVAVYAGRGGGEGG
GRLLGKLVFRFDLRRAVAEPFVFLSGWFDIGKRGAGKPAAANAARAQLNLTVLGEPDPRF
VFEFDGEPECSPQVLQVKGSMKQPMFTCKFSCRSNSDLRSRSVQSDSGAVGPRNWLAKLW
SERERERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDRVGRSNPGGWLILRRRV
DGTWTPWGRLECWRDRGGSAGDAQLGYRFELVPDHNSNVTGSGVCVAESGVPAARGGRFA
IDLTTAGSPGRGSGELSRHALWPPGGFVMSAAVQGEGRRGRPSVEIGVAHVGCAEDAAAF
VALAAAVDLSMDACRLFSCKLRRELSA*

MDPCPFVRVLVGNLALKMPASASPATPRASGSGVHPTAARCHCRIRLNKMPYQTASAPLL
PATEDGPASCTAAFAAAFHVSKADLDRAAARPAAALLLAARRRRTARLKVAVYAGRGGGV
SASCGGGGATSGRLLGKVVLPLDLRAAMAKPVVFHSGWVAVGSRRGKAAAAASSSARAQL
SITVRAEPDPRFVFQFDGEPECSPQVLQVKGSMKQPMFTCRFSCRSSSDLRSRSVQSDPG
ARNWLAKLGSERERAGKERKGWSVTVHDLSGSPVALASMVTPFVASPGTDHVSRSSPGAW
LILRPADGTWAPWGRLECWRGRGDTLGYRFELVPGHATGGAGVCVAEASVPASRGGRFAI
DLTAAAQPFWCSSSGDMGHGIWPFGGFVMSAAVQGEGRCSRPTVEVGVAHVGCAEDAAAF
VALAAAVDLSMDACRLFSCKLRRELSTASRAEFLR*

Other information
Ka divergence:-0.247261KaKs divergence:-0.496543
GC content 1 (%):75GC content 2 (%):75GC content divergence:0
Length 1 (bp):1344Length 2 (bp):1368Length divergence:0.009
MFE 1 (kcal):-779.81MFE 2 (kcal):-823.3MFE divergence0.027