Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G149028-GRMZM2G129150
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217249
Function (paralog2):hypothetical protein LOC100193211

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSANVGESTSGGSSNDAAGGSFECNICFELPQEPIVTLCGHLFCWPCLYRWLHIHAHSPE
CPVCKALVEEDKLVPLYGRGKDRVDPRSKNMPEGEIPHRPTGQRPAPAPQADANNNFANA
NPNANPWFMGTGVPLANARWGNYAFSAAFGGLFPMLSFQVHGFPDAAAYAQPAGFHYGYG
HGHGFHGGHMGHAHGVHRQAPLGQQQQADIYLKALLFMIGILVIASLIAF*

MQIYSWPASLSFFFFRYLSRQLLSLSVADDYARSSSGPRSLPPTSGAPSFPRTPRWRRAP
PVWFTPNKMSANVGESTSGVSSSDAAGGSFECNICFELPQEPIVTLCGHLFCWPCLYRWL
HIHAHSPECPVCKALVEEDKLVPLYGRGKDRVDPRSKNMPEGEIPHRPTGQRPATAPRAD
ANSNFANANANPWFPGPGVPLANARWGNYAFSAAFGGLFPMLSFQVHGFPDAAAYAQPAG
FHYGYGHGHGHGFHHGGHMGQAQAHGVHRQAPLGQQQQQADIYLKALLFMIVILVLASLL
AF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):58GC content divergence:0.036
Length 1 (bp):693Length 2 (bp):909Length divergence:0.135
MFE 1 (kcal):-255.99MFE 2 (kcal):-362.86MFE divergence0.173