Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G149238-GRMZM2G161418
Species:maize
Duplication type:WGD
Function (paralog1):TATA-box-binding protein 1 (TATA-box factor 1)(TATA-binding factor 1)(TATA sequence-binding protein 1)(TBP-1)(Transcription initiation factor TFIID TBP-1 subunit)
Function (paralog2):TATA-box-binding protein 2 (TATA-box factor 2)(TATA-binding factor 2)(TATA sequence-binding protein 2)(TBP-2)(Transcription initiation factor TFIID TBP-2 subunit)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.47504659489132
Log2 mRNA fold difference:0.48894838051925
Log2 TE fold difference:-0.046091678760162
Sequences
Protein sequence

MAEPGLEDSQPVDLSKHPSGIVPTLHGIFLKYADNSVPSNWVDEVIPCGTRRRAIFVSPG
ASAVGQRALPWGSSVLKAIRGDEMDIDYTTYWDSSDNKRIGVRNIVSTVNLDCKLDLKAI
ALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYARIIQK
LGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHGAFSSYEPELFPGLIYRMKQPKIVLL
IFVSGKIVLTGAKVREETYTAFENIYPVLAEFRKVQQCVNLSANKSR*

MAEPGLEGSQPVDLSKHPSGIVPTLHGIFLKCVGSSVPLNRGMKPFLAAISVSPGASAFK
RRGTWGSFELKESGGNEMDGEYARHWMSADVKSRVSSSVGRSGSDDLFRPYEISGWAGYA
SLVAAILKLHETVRMDWPNSWAAVVPSSSVMLRDCGTMLKIRLCSHEEGNKDRNIVSTVN
LDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLA
ARKYARIIQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHGAFSSYEPELFPGLIY
RMKQPKIVLLIFVSGKIVLTGAKVREETYTAFENIYPVLSEFRKIQQWVDGYSVQLTYVM
YSFMEHVWDWAPMTCDVKVTFFKLQASSRILV*

Other information
Ka divergence:0.1705KaKs divergence:0.235112
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):864Length 2 (bp):1179Length divergence:0.154
MFE 1 (kcal):-267.5MFE 2 (kcal):-394.57MFE divergence0.192