Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G149257-GRMZM2G089421
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100192783
Function (paralog2):LOC100281780

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGR
TGRVWNVTKRAIGVEINKQVNGRIIRKRIHVRVEHVQPSRCTEEFRLRKAKNDQLKVDAK
DRGEVISTKRQPVGPKPGFMVEGATLETVTPIPYDVVNDLKGGY*

MPAGHGLRSRTRDLFARPFRKKGYIPLTTYLRTYKIGDYVDVKVNGAVHKGMPHKFYHGR
TGSVWNVTKRAIGVEINKQVNGRIIRKRIHVRVEHVQPSRCTEEFRLRKAKNDQLKADAK
ARGEVISTKRQPVGPKPGFMVEGATLETVTPIPYDVVNDLKGGY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):59GC content 2 (%):61GC content divergence:0.017
Length 1 (bp):495Length 2 (bp):495Length divergence:0
MFE 1 (kcal):-195.7MFE 2 (kcal):-208.94MFE divergence0.033