Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G149520-GRMZM2G164956
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193470
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.66814052948135
Log2 mRNA fold difference:-0.235708761961
Log2 TE fold difference:0.90657316523703
Sequences
Protein sequence

MSPALAAGVEPMAVDDSASKKAKRKQLKAAAAAAEAEAEAASVKKKEKKEKKRKVKEPSP
PLPSAASSDEEEKSSTSSEETAPAAKKAKEKTKKNVDVSSSASDDDGEITASSDEDPADP
NALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTLAFVLPIL
ESLVNGANKASRRTEHGRTPSVLVLLPTRELANQVHADFEFYGATFGLSACCVYGGSPYR
PQEMALRRGVDIVVGTPGRVKDFIVKGTLNLKCLKFRVLDEADEMLNMGFVDDVELILGK
VEDATKVQTLLFSATLPEWVNKLSMRFLKVDRKTVDLVGNEKLKASASVKHLALPCNKAA
RAQVIPDIIRCYSHGGRTIIFTETKDSASELSGLIHGSRALHGDVAQAQREVILAGFRSG
KFQVLVATNVAARGLDINDVQLIIQCEPPRDVEAYIHRSGRTGRAGNTGVAVMLYEPRYK
HSVSRLERESGVKFEHISAPQPTDVAQSAGSEAADAIASVSDSVIPIFRQQAEQLLSSSS
LSAADLLAKALAKAVGYTDIKKRSLLSSLEDYSTLHLQTGRPMWSPGFAFTILKRFMPED
KLADVKGATLTADGTGVVFDVPAADVEDYIQASESAAQVTIDEVKQLPPLQEKDQSRGNS
GGGRFGHGGGRRFSGGGGGGRGFSGRGGGGRGFSGRGGGGSRFNRRN*

MSPALAAAVEPMAVDDSASKKAKRKQLKAAAAAAAAEAEEEAASAKKKEKKEKKRKAKEP
SPPLPSAASSGEEKSSTSSEETAPTAKKAKKDKTKKNVEVSSSASDDDGEITAGSDEDPA
DPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGSDLVGRARTGQGKTLAFVLP
ILESLVNGANKASRRTEHGRTPSVLVLLPTRELANQVHADFEFYGATFGLSACCVYGGSP
YRPQEMALRRGVDIVVGTPGRIKDFIVKGTLNLKCLKFRVLDEADEMLNMGFVDDVELIL
GKVEDATKVQTLLFSATLPDWVNKLSMRFLKVDRKTVDLVGNEKLKASASVKHLALPCNK
AARAQLIPDIIRCYSHGGRTIIFTETKDSASELSGLIPGSRALHGDVVQAQREVILAGFR
SGKFQVLVATNVAARGLDINDVQLIIQCEPPRDVEAYIHRSGRTGRAGNTGVAVMLYEPR
YKYSVSRLERESGVKFEHISAPQPTDVAQSAGSEAADAIASVSDSVIPVFRQQAEQLLSS
STLSAADLLAKALAKAVGYTDIKKRSLLSSMEDYATLHLQTGRQMWSPGFAFTILKRFMP
EEKLADVKGATLTADGTGVVFDVPAADVEDYIQASENAAQVTIDEVQQLPPLQEKQQQQS
RGNSGGGRFGRGGGGRFSGGGRGGGFGGGGRGRGGGGGRGRRRQ*

Other information
Ka divergence:0.211342KaKs divergence:0.284434
GC content 1 (%):51GC content 2 (%):52GC content divergence:0.01
Length 1 (bp):2124Length 2 (bp):2115Length divergence:-0.002
MFE 1 (kcal):-781.55MFE 2 (kcal):-799.83MFE divergence0.012