Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G149556-AC208110.2
Species:maize
Duplication type:WGD
Function (paralog1):seed specific protein Bn15D1B
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MCARSPAVRGSPIVMRLLALMPWRHCFSLGVGIFHLVMNAMNLAIVTRSLSLSLVPVCRR
AVHASAYDKNLEDQVRPAFVPDDVIGSAGSPDKYWSPHPKTGVFGPAAVDPKLAAGGAPD
AGADAAGGTVLDQKVWFRPLEDVEKPPPAA*

MDFLTLPRRDLQALCKRNGIRANMTSAAMADALRALPKVEGIEEYVKVLQPVSVLQTAVK
PVNEEQKQESPLPRGRRVTAQSSEPIEAEEDKENDAKRQSNKEGVQVPGVGRRGASRRAR
PVPAVPQTLGKAVAEEDGQGEQNLKQEAKRDSAPAPVVGRLARPSTVVIARADESEVAGV
EEEQSKEVVDDALALGVGRRGASRRARPAPSIAALAGNVVEDEEQIVPIPRGRRVKAHGN
SSEPIRLDTSYDDEKEEAKPVEEQDDAQIVGVGRRRGASRRAQAASAIAAPEAKTEEEQK
APITRGRRVKAKSTELIRLDDSSMEKKEDPKPEEETGDAPAVGAERRAPSPSKAPATRRS
GAASKAEAGDVAVEVVSSLATRQRKTMKAAAAAAEAEEKAPRRATRRGAVTSTLMQQELQ
EKPQEAIGATDEAARALPIRPTRQRKPTMKAAAAATAQEKAPIATRRGALMTLLQQDVQE
EPKEAVGAPVSHQRCDALEETKEAFVPQKEEINELDAPKQDEDEDMVIIDGEKLMEETPA
EDPPVTDQERTGKSEFQEQQVDDEEKCLATLEEPPIIGLVSMVTEQPSEDDGGVNFQDGG
GSSAALLDKNAGEEIELVAGVRALQVPLTGNGSDASHESEMRKFNEVLTVREKNSEVDTQ
EVDGDVDKVLHDSVDDTILIDCSSENVEMEKAGNVTREMPENQAALDEDVGKPNEVVIGD
KPQDTVTDKVVQEGREVLITDEMQQGTAGMHDEIEDDQFESVFVQADQVVTADNLLEQVT
DREITVEENTALIVGERQQSTVTMDDDVVEDHSDTDGDHSNEHIEAVTTVKVPELKLIED
IFVQSDHAVATDNLPEQVRDCGITMETTSLIVDEKQQIMVTVDGDLVMDGSETDNVHPDE
QMEVVTAEEVLEDTGITVEDVEEKQKSTVTVDKDVVDDHFFKTDDVHADEQMEASTTDEV
PELTEADYEVVEEKQQSTYTMNGGIEDDHFKTHVAHADEKKEVVATDVPEVTGTVGEIEE
KTSVTMDGDVVFDHADGQKEVIVTEVPDEVTVTGDEGVERKAAVITEAIPDHGTAPSIAH
TMNGCVKETHFGDGNEQKKVITADIISIPQDDCVRKENASSIDVAESLSSNKSSGCKNSS
EKNTTEPMAVLKDKGLKATKKPVDLLALSLGKLKAKLKDRLNAEKKKEAKRLALARVDEN
VCRSIPRKGAGQQRNLNLQQH*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):66GC content 2 (%):52GC content divergence:-0.119
Length 1 (bp):453Length 2 (bp):3666Length divergence:0.78
MFE 1 (kcal):-198.9MFE 2 (kcal):-1347.59MFE divergence0.743