Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G149580-GRMZM2G136262
Species:maize
Duplication type:WGD
Function (paralog1):LOC100284652
Function (paralog2):hypothetical protein LOC100193006

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAHSLAASFSPAAARRQVTNVIPSWTSVSFQSHRMTSVSIRSRQRSLGFKICCSAKKETV
DKVCSIVKEQLALPDGTAITAESKFAELGADSLDTVEIVMGLEEAFNITVDETSAQDIAT
VQDAADLIEKLMLEAPPKVV*

MAHSLAASFSPAAARRQVTNVISSRSSVSFQSHRMTSVSIRSRPSSLRFKICCSAKKETV
DKVCSIVKEQLALPDGTAITGESKFAELGADSLDTVEIVMGLEEAFNITVDETSAQDIAT
VQDAADLIEKLMLEAPPKVV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):55GC content 2 (%):54GC content divergence:-0.009
Length 1 (bp):423Length 2 (bp):423Length divergence:0
MFE 1 (kcal):-144.16MFE 2 (kcal):-144.23MFE divergence0