Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G149636-GRMZM2G104626
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):senescence-associated protein 15 (LOC100285592), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MESAPAAVMERERLTAEMAFRGADEARRDGGEPAPSIVIKIRRRLPDFARSIKLKYVRLG
IRHGGSPTSVLPMLCVPAVAAAAYSFVRLDVIYYSIDLLTCVAWLGTALLLLTVYYFKRP
RPVYLVDFACYKPEEQLKISKSAFLEMTESTGSFNEAALDFQTKITNRSALGDETYLPPG
VQARPPRLNMAEARMEAEAVMFGCLDALFESTGIDPRRDVRILIVNCSLFNPTPSLASMI
INHYRMREDVKSFNLGGMGCSAGLIAIDLAKDMLQANPGSYAVVLSTENITLNWYFGNDR
SMLLSNCIFRMGGAAALLSNRRADAGRAKYRLLHTVRTHKGATDECFNCVYQREDEVGKV
GVSLARELMAVAGDALKTNITTLGPLVLPLSEQLKFLKSLMMRRVFRVKGVRPYIPDFRR
AFEHFCVHAGGRAVLEEVQRSLSLQDTDMEPSKCSLHRFGNTSSSSLWYELAYAEAKGRV
RRGHRVWQIGFGSGFKCNSAVWRALRDVPPLSSSTGAAAGPPGRKGAQSCCNPWVDDVDR
YPPKAYV*

MEEAAPAAVMERERLTAEMAFRGADEARREGGDPAPSIVIKIRRRLPDFARNIKLKYVKL
GIRHGGSPTSLLPALCVPAVAAAAYSFVRLDVIYYSVDLLTCVAWLGTALLLLTVYYLKR
PRPVYLVEFACYKPEERLKISKSAFLEMTESTGSFNEAALDFQTKITSRSALGDETYLPP
GVQARPPRLNMAEARKEAEAVMFGCLDALFESTGIDPRRDVRILIVNCSLFNPTPSLASM
VINHYRMREDVKSFNLGGMGCSAGLIAVDLAKDMLQANPGSYAVVLSTENITLNWYFGND
RSMLLSNCIFRMGGAAALLSNRRADAGRAKYRLLHTVRTHKGATDECFNCVYQREDEAGK
AGVSLARELMAVAGDALKTNITTLGPLVLPLSEQLKFLRSLMMRRVFRVGGVRPYIPDFR
RAFEHFCVHAGGRAVLEEVQRSLSLRDTDMEPSKCSLHRFGNTSSSSLWYELAYAEAKGR
VRRGHRVWQIGFGSGFKCNSAVWRALRDVPPLPSSPGAAAGPGARKGTCCNPWVDDVDRY
PPKAYV*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):68GC content 2 (%):69GC content divergence:0.007
Length 1 (bp):1644Length 2 (bp):1641Length divergence:-0.001
MFE 1 (kcal):-801.1MFE 2 (kcal):-816.9MFE divergence0.01