Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G149717-GRMZM2G314647
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):dynamin-related protein 1A

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.88058916080006
Log2 mRNA fold difference:-0.36099027598638
Log2 TE fold difference:-0.5159891358589
Sequences
Protein sequence

MDNLITLVNKLQRACTALGDHGEESALPTLWDSLPAIAVVGGQVPFFPSRARFFALVLIG
SGAVAPASWVWISRVAGGTARSSGKSSVLESVVGKDFLPRGSGIVTRRPLVLQLHRIDGD
REYAEFMHLPRKRFTDFAAVRKEIADETDRETGRSKQISTVPIHLSIFSPHGKMQTLEGY
IVTVALSHLNCPLPIVNLTLIDLPGLTKVAVDGQPESIVHDIENMVRSYIEKKCTVVDSG
ERTFGVLTKIDLMDKGTDAVDILEGRSYRLQTPWVGVVNRSQQDINKNVDMIAARRRERE
YFASTPEYKHMASRMGSEYLGKMLSKHLEQVIKSRIPGIQSLITKTIAELETELNRLGKP
IANDAGGKLYTIMEICRMFDGIYKEHLDGVRPGGEKVYHVFDNQFPVAIKRLQFDKQLSM
ENVRKLITEADGYQPHLIAPEQGYRRLIESCLISIRGPAEAAVDAVHAILKDLVRKAINE
THELKQFPTLRVEVGNAAFESLDRMRDESKKNTLKLVDMECSYLTVDFFRKLPQDVEKGG
NPSHSIFDRYNDSYLRRIGQTVLSYVNMVCSTLRNSIPKSIVYCQVREAKRSLLDHFFTE
LGAREMKQLSKLLDEDPAVMERRTNLAKRLELYRSAQSEIDAVAWSK*

MDNLITLVNKLQRACTALGDHGEESALPTLWDSLPAIAVVGGQSSGKSSVLESVVGKDFL
PRGSGIVTRRPLVLQLHRIDGDREYAEFMHLPRKRFTDFAAVRKEIADETDRETGRSKQI
SPVPIHLSIFSPYVVNLTLIDLPGLTKVAVEGQPENIVQDIENMVRSYIEKPNCIILAVS
PANQDLATSDAIKISREVDPKGERTFGVLTKIDLMDKGTDAVDILEGRSYRLQTPWVGVV
NRSQQDINKNVDMIAARRREREYFATTPEYKHMASRMGSEYLGKMLSKHLEQVIKSRIPG
IQSLITKTIAELETELNRLGKPIANDAGGKLYTIMEICRMFDSIYKEHLDGVRPGGEKVY
HVFDNQFPVAIKRLQFDKQLSMENVKKLITEADGYQPHLIAPEQGYRRLIESCLISIRGP
AEAAVDAVHAILKDLVRKAINETHELKQFPTLRVEVGNAAFESLDRMRDESKKNTLKLVD
MECSYLTVDFFRKLPQDVERGGNPSHSIFDRYNDSYLRRIGQTVLSYVNMVCSTLRNSIP
KSIVYCQVREAKRSLLDHFFTELGAREMKQLSKLLDEDPAVMERRTNLAKRLELYRSAQS
EIDAVAWSK*

www.000webhost.com

Other information
Ka divergence:-0.513056KaKs divergence:-0.658333
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1944Length 2 (bp):1830Length divergence:-0.03
MFE 1 (kcal):-610.51MFE 2 (kcal):-556.02MFE divergence-0.047