Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G149768-GRMZM2G154218
Species:maize
Duplication type:TD
Function (paralog1):elongation factor alpha2
Function (paralog2):elongation factor 1 alpha

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.12325481369892
Log2 mRNA fold difference:-0.076734259259515
Log2 TE fold difference:0.20018142942789
Sequences
Protein sequence

MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYEEIVKEVSSYLKK
VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD
VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV
KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT
VAVGVIKSVEKKDPTGAKVTKAAAKKK*

MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
DKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT
GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKK
VGYNPDKIAFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQITEPKRPSDKPLRLPLQD
VYKIGGIGTVPVGRVETGVIKPGMVVTFGPTGLTTEVKSVEMHHEALQEALPGDNVGFNV
KNVAVKDLKRGFVASNSKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKF
AELITKIDRRSGKELEKEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQT
VAVGVIKSVEKKDPTGAKVTKAAAKKK*

www.000webhost.com

Other information
Ka divergence:-1KaKs divergence:-0.981982
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):1344Length 2 (bp):1344Length divergence:0
MFE 1 (kcal):-490.9MFE 2 (kcal):-510.67MFE divergence0.02