Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G149905-GRMZM5G835039
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383465
Function (paralog2):hypothetical protein LOC100275470

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.9514120357422
Log2 mRNA fold difference:-2.7599360112066
Log2 TE fold difference:1.9344315991453
Sequences
Protein sequence

MSYAHASRHRGGGMPPTTALAAKVALASAALAAFASLARLAVPRLVAVAAAVLPRAWAAA
RLWLVPPYLFVTVHLIILVIWKLSDHRHSQQQAAAAQHKDDPWPPAAELPSTAAAATPAV
RAKEEQYGQPLPAEFSSPSPDSGGGGSCVTTESDEDASSPSPDVLWRSLAPAPQERAVVL
EREPSLPPSQAVDGDDDDDDLDATWNAIMQKTRPAAPAATPPAPAPAPAAHHQQRPPPRA
RDPSVGAEEMNRRFDDFIKKNRNSFGRQ*

MPHGHRGMQPATTVLAVKAALALAAAASLARLAVPRLASAAGAVLPRVWAAARLCLVPPY
LFVTVHLIILVIWKLSSDHSHVHVHHQPGAPPSPAAHARAAEVPVPPVKAKAKQEEDCED
LQAEFSPTGSGGGGSESCVTTESDEDASSSALLEREREPSLDGDADHDLDATWNAIMRRT
RPAPAAPAPAQHQHQHHHHQPPRTRDPSVGAEEMNRRFDDFIEKNRNSFGRR*

Other information
Ka divergence:0.432745KaKs divergence:0.291692
GC content 1 (%):74GC content 2 (%):73GC content divergence:-0.007
Length 1 (bp):807Length 2 (bp):699Length divergence:-0.072
MFE 1 (kcal):-390.91MFE 2 (kcal):-337.9MFE divergence-0.073