Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G150160-GRMZM2G076827
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191811
Function (paralog2):hypothetical protein LOC100194279

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAETSTYQILVRLLDGRTRCLRFSTPTVSGAVLLDAVASISRVPAAALRLVTGGIDVSPS
SVLASAADGQFPYASALLRLRGGKGGFGSLLRGAASKAGQKKTSNFDACRDINGRRLRHV
NAERRLEEWKAEAADRQLEKLAENFIKKKAKEAGRGGGPSTAEVDKYLEKYRKDAEICVN
VVEESVRASLGKRKTAPKLPSGADAKKLKFWLGKNKVEEDESDSDTDVDDEDIEDLKSAD
AKSVVVDEGNYSNGCRKNEEKLDLGSVSGSSHSEGESSGEKSQLTTSSGAEGGDFESGDS
AELEVGMLDHPISVAAASEEVTADEDNTALATSNQNNPEVPQVEEVRKADKDNTASATSN
QNNQEVPQVEQHVGISNSYSEPLDLAKYSSSAELEVLGLEKLKIELQSRGLKCGGTLQER
AARLFLLKTTPLDKLPKKLLAKTNGRK*

MAEAPTYQILVRLLDGRTTCLRFSTPTVSGAVLLEAVASISRVPAAALRIVTGRFDVSPS
NVLTSSADGQFPSASALLRLRGGKGGFGSLLRGAASKAGQKKTSNFDACRDINGRRLRHV
NAERRLEEWKAEAGDRHLEKLAENFIKKKAKEAGRRGGPSAAEVDKYLEKYRKDAEICVN
AVEESVRASLGKRKTAPKPPSGADAKKLKIWLGKNKVEEDESDSDSDSDMDDEDSEDQES
ADAKSLVVDEGNCSNGSIKNEKLDLGSVSGSHSEGESSGEKSQPTTKSGAEGGDFESDGS
AEPELGMVDHPIPVNNAVAAASEEVLKSDEVTADEDNTTSATSNQNNPVVPQVKEALKAD
EDNSASATSNQNNPEVPKVEEYADASKSYSEPLDLAKYSSAVELEVLGLEKLKIELQSRG
LKCGGTLQERATRLFLLKTTPLDKLPKKLLAKAAIGGK*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):53GC content divergence:0.01
Length 1 (bp):1344Length 2 (bp):1377Length divergence:0.012
MFE 1 (kcal):-469.91MFE 2 (kcal):-487.4MFE divergence0.018