Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G150264-GRMZM2G103628
Species:maize
Duplication type:WGD
Function (paralog1):LOC100285679
Function (paralog2):beta3-glucuronyltransferase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLSSRRNSGIILREGSVRDWSEFNDPSPSPKPLYSQSYVAVRGFLLSSKLKSVYAAMTSQ
RHSRSQERSKSKGLSCRRVAVRLLFFFMLGIFIGFMPLFSVDVYKKIVSENKMLPFHEGV
IETEMVGTKVKESETIVVEKEIELIDEPHIQESPPVPALLDDDVDFSESSPVLPAIRESD
IPVKKLLIIVTITSVRPQQAYYLNRLAHTLKAVQAPLLWLVVEWPEQSYETAEILRSSGV
MYRHLMCRKNTTSVRKIAVCQRNNAIYHVKRHHLDGIMHFADEERSYSADVFEEMQKIRR
FGSWPVTIHIGTKYRAVLEGPICKANRVMRWHTVQTVQKKSSTRRFPIGFSAFAFNSTLL
WDPQRWNRPPMDSVIIHTGGRGGLQESRFIEKLVKSERQIEGLPDNCNRVMVWNFNLEPP
QLNYPAGWALYKNLEADMPVI*

MVSSRRNSGIILREGSVRDWSEFNNPSPSPKLLYSQSYVAMRGLLASVISLDFFLLSSKL
KSVCAAMTSQRHGRSQERSKSKGLTCRRVAVHLLFFFMVGIFIGFMPLFSVDVYKKIVSE
NERLPFHDGVIEAEMMGTKVKELETVVVEKEVELIDEPQVQESPPVPAMLDDEADFAESS
PALPAIEESDIPVKKLLIIVTITSVRPQQAYYLNRLAHVLKAVQAPLLWLVVEWPEQSYE
TAEILRSSGVMYRHLICRKNTTSVRKIAVCQRNNAIYHVKRHHLDGIMHFADEERSYSAD
VFEEMQKIRRFGSWPVAIHVGTKYRAVLEGPICKGNRVMGWHTVQTVQKKSSTRRFPIGF
SAFAFNSTMLWDPQRWNRPPMDSVMVHSGGRGGLQESRFIEKLVKNERQVEGLPDNCSRV
MVWNFNLEPPRVNYPTGWALYKNLEPDMPVT*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):1326Length 2 (bp):1356Length divergence:0.011
MFE 1 (kcal):-422.6MFE 2 (kcal):-458.62MFE divergence0.041