Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G150286-GRMZM2G172930
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100276607

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.0919406169126
Log2 mRNA fold difference:-0.113844685226
Log2 TE fold difference:1.2985343363539
Sequences
Protein sequence

MASLSRTAAAAVVALRSAVRSAPLTGRVLGAPLPSFASPSATRSARILRRSAAAASAGLE
TLMPLHSAVAAARLRSCIAVDSSCWCSLSQGLNKRI*

MASLSRTAVAAVRSAARSAPLTGRVPGAPLPSLASSSAARSARILRRSAAASSSGLETLM
PLHSAVAAARLRSCIAVDFSCWSSLSQGQVHGATALGACVHSLTYWLSVLNGAYQFGNL*

Other information
Ka divergence:0.116356KaKs divergence:0.0833824
GC content 1 (%):69GC content 2 (%):64GC content divergence:-0.038
Length 1 (bp):291Length 2 (bp):360Length divergence:0.106
MFE 1 (kcal):-120.03MFE 2 (kcal):-137.3MFE divergence0.067