Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G150496-GRMZM2G067299
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):inositol polyphosphate 2-kinase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MKDRHLALNQTQRVRLEAALQELQSVAPAAAVTVADTIPVNQEDNILKGHGTSDQDGEVV
ATLCGVVERVNKLVYVRTLRASCRFSMEMNGVLQAADAKYWVYKGEGAANLILSYTGSSP
TMLGKVLRVKKLLNDKSQLPPSCMVFSSHEQLLWGHIPELVESVKQDCLAQAYAVHVMSQ
HLGANHVDGGVHVRVSRDFLELVEKNVLSSRPPWRVNASSIDITADAALLIADHSLFSGT
PKGSSCIAVEIKAKCGFVPSSEYISKDNSIKKQVTRYKMHQHLKFHQGEISKTSEYNPLD
LFSESKERISMAIKSFFSTPQNNFRIFVNGSLAFGGMGGGADSVHPADTDKCIKDLSKVS
GLELPDFTELLSETIFKSGVLGKLLTTQKLDDHDIEGAIHLYYNIISQPCLVCKNLTDVE
LLRKYTLLHSLPLDKSLKIVRNFLISATAKDCSLMISFRPRENGSTDSEYDSVFLESAKR
TYEYKTYFVDLDVKPLDKMVHYFKLDQRIVNSYTRYGEVLPPPKGK*

MEMDGVLQAADAKDWVYKGEGAANLILSYTGSSPSMLGKVLRLKKILKNKSQRAPSCIVF
SSHEQLLWGHIPELVESVKQDCLAQAYAVHVMSQHLGANHVDGGVRVRVSRDFLELVEKN
VLSSRPAGRVNASSIDNTADAALLIADHSLFSGNPKGSSCIAVEIKAKCGFLPSSEYISE
DNTIKKQVTRYKMHQHLKFYQGEISKTSEYNPLDLFSGSKERICMAIKSLFSTPQNNLRI
FVNGSLAFGGMGGGADSVHPADTLKCLEDLSKISGLKLPDFTELLSETIFRSEVLGNLLA
TQKLDDHDIEGVIHLYYNIISQPCLVCKNLTDVELLRKYTFLHSLPLDKSLKIVRDFLIS
ATAKDCSLMISFRPRENGSTDSEYDSVFLESVKRTYEYKAYFLDLDVKPLDKMEHYFKLD
QRIVNFYTRNGGGLAISKGQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):44GC content divergence:-0.033
Length 1 (bp):1581Length 2 (bp):1323Length divergence:-0.089
MFE 1 (kcal):-511.28MFE 2 (kcal):-407.44MFE divergence-0.113