Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G150838-GRMZM2G025215
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272723
Function (paralog2):LOC100281396

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MNASQFMDKQILGLAASASPSGGGAGGGGGVDLSDLMIPIPQEDGEDRLRRRRSSSSVNG
TSDDMLPSYDFQPIRTGGATAAAPVSQASWGSLDSKAPSASASASAAASYNLKSAGILEP
HVLKKVSHEEDRSNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVD
ELKLTIGNYNGSTDGKLRHLENMLREVQAGVQILRDKQEIVEAQLHLAKLQTTKTDAHSS
ENSGSGHAGSQPVPPPQAAIQPQQVLTPLQPPALPALPAPNAPLPTLQSQPPSQFPSHLQ
HSQVPSVPSVAPVPSVPALPRDAYYAPSSQPTETMHQQYQAPPVPQPQAPPAPQQYQSPS
QFPQYSQPSQPSNVNPPTPHVPPAPQQPEETMPYPPPQSYAPNARPPSPYMQPPSGPAPP
YYGQQNPTMYEPPAGRANPGPPSSYGSGGYGPQGGSGFSDSYGYAGSPSHRGNAGMKPST
PFAQSSGGSGGYGSGRLPTAQILPQAVPVSSSSTSGASGNRVPLDDVVEKVATMGFSREQ
VRATVRRLTENGQNVDLNVVLDKLMNGR*

MNASQFMDKQILGLAASASPSGGGAGGGGGVDLSDLMIPIPQEDAENRLGRRRSSTSVNG
TADDMLPSYDFQPIRTSGGAAAAAAPQASWGSLDSKAPSASYNLKSAGILEPHVLKKVSH
EEDKSNFPTVTIADIDRTMKKYSDNLLHALEGVSSRLSQMEGRTHQLENSVDELKLTIGN
YNGSTDGKLRNLENMLREVQAGVQILRDKQEIVETQLHLAKLQTNKTDGQSSENSGSGQA
GLQQQPVVPPQAAIQPQQVLTPSQPPALPALPAPNAPPPPPTLQNQSSLQFPSHLQHSQV
PSVPSVALAPTVPALPRDAYYAPSAQPTETMHQQYQAPPVPQPQAPPAPPQQYQSQTQFP
QYAQPPQPANVNPSTPHVPHAPQQPEETMPYAPAQSYPPNAIAAPYMQPPSGPAPPYYGQ
QNPSMYEPPAGRANPGPPSSYGSGGYGPQGGGSFSESYGYTGSPSHRGNAGMKQSSPFAQ
SSGGSGSYGSGKLPTAQMLPQAVPISSSSTSGSSGNRVPLDDVVEKVATMGFSREQVRAT
VRRLTENGQNVDLNVVLDKLMNG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):55GC content 2 (%):54GC content divergence:-0.009
Length 1 (bp):1707Length 2 (bp):1692Length divergence:-0.004
MFE 1 (kcal):-585.28MFE 2 (kcal):-586.69MFE divergence0.001