Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G150859-GRMZM2G114046
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100384015

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MNAFFTSLARGLDDLGRAGGLSSLSALLRAAALLRGLHSQLTLMVGQLHLPPGGRWLDEY
MDETARLWDACLALKLGLASVERYCAAASCAAAALDDWLQDPSPLSTRQVMRAISVSRRE
AMAAEEENRALADARIAPLSLHLDERLLLRATDARLAGFNGFRGLLYALHNASSLLLLIL
ASGAVSCAAAAGGPCAGADDAGSDGFTASIAMLQQRLAEEAESDGPGAAPGIRMCEFRCA
RAAVEAAREEVERAAAAGRKCEGGGGGSAVKDKVEELKAWLDVLRTGTDSLVCQLDDFLD
DIVEGRKELSDLCSH*

MNAFFTSLARGLDELGRAGGLSSLPALLRAASLLRGLHSQLTLMVGQLHLPPGGRWLDEY
MDETARLWDACLAVKLGLASVERYCAAASCAAAALDDWLQDPSPLSSSQVMRAISVSRRE
AMAAEEENRALADARIAPLSLQLDERLLLRATDARLTGFNGFRGLLHALHNASSLLLLIL
ASGAVSCAAAAGGPCGADDAGAGFVASIVMLQQRMAEEAADAESDGPGAPGIGMCEFRCA
RAAVEAAREEVERAAAAAAAAAAAAAGRKCEGGGVVKDKVEELKAWLDVLRTGTHSLVCQ
LDDFLDDIVEGRKELSDLCSH*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):72GC content 2 (%):72GC content divergence:0
Length 1 (bp):948Length 2 (bp):966Length divergence:0.009
MFE 1 (kcal):-531.3MFE 2 (kcal):-536.4MFE divergence0.005