Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G150867-AC149818.2
Species:maize
Duplication type:WGD
Function (paralog1):Ubiquitin carrier protein (EC 6.3.2.-)
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSSPSKRREMDLMKLMMSDYKVDMVNDGMQEFFVEFRGPNESIYQGGIWRVRVELPDAYP
YKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFEVFLPQLLLYPNPSDPL
NGDAAALMMRDRPAYEQKVKEYCEKYAKPEDAGVSPEDESSDEELSEEENDSGDEEIMGK
PDT*

MRIRRYAARLLSATTAAPSSPPRPPAASWLHTDDDDDCCAFCELSRPAPQEGQDAVKHKG
HIAGRVPESDVRADERVGLHQRPPAPEVKKCKIDHVPPVDKSSVGLQVVKCASEVSGAVA
KPEGGTPASEAAAGPAAKAGAFVVNDAASEQGVQCIASPLGGASKLEEVTAGNSFANGPT
TELGVFKGASLANELADVPGVTSIMPEVIGKPSTDPGAITTVVEVSDIGSVVHETTELES
AGEDYIASEAAAEPEDAGRASCNTDDTAALDEPLPPSCDPNIGNAQVGNAMDTVASTVRP
SRCDAAEEGASVNSTANGPVRARGPTVKGGVPKDKSVAPSVLRVLDVVTRSIGKSGRTDV
ICYARRTGKRKPELQEVKTENIDLEDGVLCEKEEALLRTDCCESVLSTAGSIDVKLADIK
KDLMDNSAASKVTKMKRNIFECKIDYCHMTFKTKAELAAHKKNMCTVNSCSKHFRSHSYL
RRHESAHNDDMPYKCPWDGCNMAFKWSWDRAEHFKVHAGAKPYKCMTPGCSKMFKFVSDF
TRHRRRCKPQR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):45GC content 2 (%):51GC content divergence:0.063
Length 1 (bp):552Length 2 (bp):1656Length divergence:0.5
MFE 1 (kcal):-157.3MFE 2 (kcal):-573.15MFE divergence0.569