Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G150932-GRMZM2G075124
Species:maize
Duplication type:WGD
Function (paralog1):casein kinase I isoform delta-like (LOC100285265), mRNA
Function (paralog2):hypothetical protein LOC100192492

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDHVVGGKFKLGKKIGSGSFGELFLAVNVQTGEEVAVKLENVKTKHPQLHYESKLYMLLQ
GGTGIPHLKWFGVEGEYNVMVIDLLGPSLEDLFNYCSRKFSLKTVLMLADQMINRVEYMH
QKGFLHRDIKPDNFLMGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYA
SVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTPVEVL
CKSYPSEFISYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQFDYVFDWTILKYPQIGS
NPRMRAGERTSGAAGPSMDKIEKATGEAGGRRNLSGPVNQTDSYAQRPRETVSMSLKEIM
HSTDRSGERTMERPRTSSRTGSASRRAVASSSRQASSVEPSEQQYSRASRLFSSNSGSRP
SSTQRVNPSPGEARATSLSRAAVARGARDEPLHRSLELLSLGGGGKRK*

MDHVVGGKFKLGKKIGSGSFGELFLAVNVQTGEEVAVKLENVKTKHPQLHYESKLYMLLQ
GGTGIPHLKWFGVEGDYNVMVIDLLGPSLEDLFNYCSRKFSLKTVLMLADQMINRVEYMH
QKGFLHRDIKPDNFLMGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYA
SVNTHLGVEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTPVEVL
CKSYPSEFISYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQFDYVFDWTILKYPQIGS
NPRTRAGERTSGAAGPSMDRIEKTPGEASGRRNPSGPVNQSDSYAQRPRETVSMSLKEIM
HSTDRSGERTVERPRTSSRTGSASRRAVASSSRPATSSMEPSEQQYSRASRLFSSNSGSR
PSSAQRVNPAPGESRATSLSRAAVARGSRDEPLHRSLELLSLGSGKRK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):53GC content divergence:0.019
Length 1 (bp):1407Length 2 (bp):1407Length divergence:0
MFE 1 (kcal):-492.81MFE 2 (kcal):-493.1MFE divergence0