Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G150962-GRMZM2G162928
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281702
Function (paralog2):hypothetical protein LOC100384017 (LOC100384017), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.68071106185435
Log2 mRNA fold difference:0.53177950624193
Log2 TE fold difference:0.14051434356875
Sequences
Protein sequence

MAAAPPPCSSCSCSCRIRGRKQAPARRALPTVASLVPCFLLLLLVVASCQPALVSAAHGG
GGGGGRKHAAAAARAHAHAQQTLFRAAGDEREEAYRRVMARMARMDRDSNMTIQSPDGDV
IRCVPSHLQPAFDHPVLRGQKPEDEPVERPMPPKRVGGAAEEEEDDDVFPQAWSDGGKRC
PEGTVPIRRTTARDVLRASSARRFGMKARASHHARRDSTSSGHEHAVGYVTGDQFYGAKA
SLNVWSAKVASAAEFSLSQIWVISGSFGNDLNTVEAGWQVSPELYGDSSPRFFTYWTTDA
YQETGCYNLHCSGFVQTNNRIAIGAAISPTSVYNGRQFDISLLIWKDPHRGNWWLQLGST
GQLVGYWPSFLFTHLGGHANMVQFGGEVVNSRPSGSHTPTQMGSGHFPREGSNRAAYFRN
VQVVDGDNSLVPAAALRLVADHPACYDIQGGYNRAWGNYFYYGGPGRNVHCP*

MSSSSGCNRGRAVLPVTASLVPFLLLLVVVSCQAALVVSATHTHGHGGGKHAGAARAAFR
AGDEQEAYARIMARMARMDKDSNMTIQSPDGDVIHCVPAHLQPAFDHPRLRGQEPEDEPV
ERPMSKGGAAEEEAGVFPQAWSDGGSKRCPAGTVPIRRTAARDVLRASSARRFGMKARGG
GSSSSNARRDSTSSGHEHAVGYVTGDQFYGAKASLNVWPAKVASAAEFSLSQIWVISGSF
GNDLNTIEAGWQVSPELYGDSSPRFFTYWTTDAYQETGCYNLHCSGFVQTNSRIAIGAAI
SPTSVYNGRQFDISLLIWKDPHRGNWWLQLGSGPLVGYWPSLLFTHLGAHADMVQFGGEV
VNSRPAGAHTPTQMGSGHFPREGSNRAAYFRNLQVVDADNSLVAAAALRLVADRPGCYDI
QGGYNTAWGNYFYYGGPGRNVHCP*

Other information
Ka divergence:0.130027KaKs divergence:0.0353414
GC content 1 (%):69GC content 2 (%):69GC content divergence:0
Length 1 (bp):1419Length 2 (bp):1335Length divergence:-0.031
MFE 1 (kcal):-738.55MFE 2 (kcal):-677.56MFE divergence-0.043