Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G151257-GRMZM2G125991
Species:maize
Duplication type:WGD
Function (paralog1):endoglucanase 1
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRAGAAARGDSPRAMSAAATPRHRLGVALLLLLVLGGADAKAHSYEDALRKSLLYFEAQR
SGRLPHSQRVTWRHHSGLTDGLEQGVDLVGGYYDAGDHVKFGLPMAFTVTMLSWSLIEYG
ADVAAAGELGHALEAVKWGTDYFVKAHTRPDELWAEVGDGDTDHYCWQRPEDMTTSRQAY
KVDRDHPGSDVAGETAAAMAAASIVFRDSNPHYAHLLLHHAQQLFEFADKYRGKYDSSIA
EVKSYYASVSGYKDELLWAALWLHRATGRADYLDYVVDNADSFGGTGWAINEFSWDVKYA
GVQILAARLLLRGEHATRHRSTLERYRAKAERYVCACLGRNTEGGADANVERSPGGMLYV
RQWNNMQYVTSAAFLLSAYSDYLAEAGVRTVSCAGGETVAAREVAALARAQVDYVLGTNP
RGVSYLVGYGPKYPSRVHHRAASIVPYKHSKEFIGCTQGFDHWFGRRSSNPNVLVGAIVG
GPDRRDRFRDNRENYMQTEACTYNTAPMVGMFAKLHRLARQEREQGPTPAPAPAPVTSAA
ADV*

MLYVRQWNNMQYVTGAALLLSAYSDYLAAAEAGGAARAVSCAAAAEEVFALARAQADYVL
GTNPRGASYLVGYGSRYPGRVHHRAASIVPYKHSREFIGCTQGFDHWFGRRGSNPNLLVG
AIVGGPDRRDRFRDSRDNYMQTEACTYNTAPMVGVFAKLRRMAWLEREQGSTSVPVTVTS
TAAEV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):70GC content 2 (%):70GC content divergence:0
Length 1 (bp):1632Length 2 (bp):558Length divergence:-0.49
MFE 1 (kcal):-845.66MFE 2 (kcal):-281.7MFE divergence-0.5