Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G151407-GRMZM2G052671
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100275623
Function (paralog2):hypothetical protein LOC100384128

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAGASNHGSLTDEWLPPPTPSPRSLVSSFLNEEFSPGPFSGLFSKHGANRPHDQSEKGRG
ALNSSEEFPTHAVKDPFQKGFSLEPNLFSANHISNSNGGLAERRAARAGFSVPKIDTSRV
GSSAVIRSPVSIPPGLSPTTLLESPVFLYNKMAQPSPTTGTLPFLTATNDKSTIPPATKI
TEDSAVYNDVFSFQPHLGSKETGFSTAEKDYGAYQQKHSLWNIHQQESSLQSSFTAVKDN
TSATIGETKTSSSMFSDSHYSADQQQGEETNMKEQGKGVEARSAAFLPAPVHNDASLLDS
QDAVDVSSTLSNEEDERATHGTVSIECEGDEDETESKRRKLELDALGAIAIATTSTTSTI
DMGPASSRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCSVR
KHVERASHDLKSVITTYEGKHNHEVPAARSSGQGSSGSGSGPSAPQAGGSHRRQEPAQAS
FAHFGTSPFSSFGLAPSGQLGPTTGNFRFGMVPPGATIPMPSLGSLAPTKMIGNPSAMQG
YPGLMMPGEPKVEPFSRPHFPTSIAPPPAYQQILSRPPFGHQM*

MSGASNYGSLIDEWLLPPTPSPRTLMSSFLNEEFSSAPFSGPHDQSEKSREVLNSSDEVP
SHAVKGPFQNGFPNLFSAKSNSNGGLAERRAARAGFSVPKIDTSRVGSSTVIRSPVSIPP
GLSPTTLLESPVFLYNKMAQPSPTTGTLPFLMATNDKSTISPAAKITEDSTFDNDVFSFQ
PHLGSEQTGFSTAEKDYGAYERKQSLSNIHQQESSLQSSFTAVKDNTSATIVKAKPSSSS
MFSDSHYSADQQQADETNIKVQGKGVEARSAAFAPVSAHSDASLLESQEALDVSSTLSNE
EDERATHGTVSIECDGDEADAVSKRRKLELDALEATATATTSTTNTIDMGPAASRAVREP
RVVVQTTSEVDILDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCSVRKHVERASHDLKSV
ITTYEGKHNHEVPAARNSGQGSSSAPSASQAVGSHRRQEPAQASFAHFGTASFSSFGLPP
SGQLGPTTGNFGFGMVPPGMTIPVPSLGSLAPVKMVGNSSTMQGYPGLMVPGEPKAEPVS
QPLIQMANASPPAYQQILSRPPFGHQM*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1752Length 2 (bp):1704Length divergence:-0.014
MFE 1 (kcal):-551.86MFE 2 (kcal):-529.7MFE divergence-0.02