Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G151418-GRMZM2G034882
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193088
Function (paralog2):hypothetical protein LOC100276570

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRAGDAFSNYRCRTMSMNYDGDRSEDRQSEEVQSAYKRDSDVGEEMIISSEEQNDENEWS
WVNQDRNGDPFAESVSSLHTTQQILENEIRKLSELGKELEAEESTSGNKDQDVILLPYSE
ADVLELSEKMEHLEQKVKEASNTIREKDLMLSKLQILIGTADRAALEEELEEAAASIDQL
ETELERHLQEKLEAEIQCLLMLKASQNWQVRAEDRVALEEHRALSAGDKTRMLLKLRETE
SKIVMLKEQVDKLEVREKELNRTTEVLKMQSRTFRASLFGLVQLVMLCLSLKVFFARVSA
PFDEAVPT*

MLMHYDVDRSEDRQSEEVQSAYRRDSDIGEEMIISSEEQNDENEWSWVNQDRDGGPLAES
VSSLHMTQQVLENEIQKLSELGKELEAEESTSGNKDQDVIVLPYAEVDMLKLNEKMEHLE
QKVKEVSNTIREKDLRLSKLQILIGTADRATVEEAAASIDQLETEFEHHLQEILEAEIQY
LVMMKARQNWQVRAEDQMALEEHRASAAGDNTRMLLKLRETESKIVMLKEQVDKLEVREK
DLYRTTEVLKMQSRTFKVSLFGLVQLIMMCLSLKMFFAQVSAPFDEVVPT*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):48GC content divergence:-0.03
Length 1 (bp):927Length 2 (bp):873Length divergence:-0.03
MFE 1 (kcal):-317.7MFE 2 (kcal):-283.7MFE divergence-0.057