Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G151496-GRMZM2G405474
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100382223
Function (paralog2):hypothetical protein LOC100274552

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.434481051064
Log2 mRNA fold difference:-3.8524237866169
Log2 TE fold difference:1.431970357802
Sequences
Protein sequence

MSFSSMSKQQVLDAGDGEGEEVMELIPGLPEEVAEKCLLHLPFLYHRLFRTVSSTWNRFL
TDALAKPLLFPHAAGAGTAATGSVPFLFALAFDPMSRRLQCQALDRFSRKWLLLPPVPGG
AAAGSFAVVGLPRRGQIYVIGGVEEGGDKAVTSVAVYSAARNGWEEAAAMRTPRGYMAAG
EVGGRVVVAGEDGEAEVFDPEAGRWSPAAPRRGAAVARYDAAAAGGKLYVTEGWAWPFER
APRGAVYDAAADSWCEMARGMREGWTGSCAVAGGRMYIVAEYGEWRLKRYDEARDEWRMV
AGTGVPPEVRRPHVVAGELGEVAGGRRRIYVVGAGLDVAVGTVSAAASAAAAVPGVEDEV
VEWEVVKGSAEFAGMAPCNAQVLYA*

MSFSSMSKQQVLDAGDGEGEEVVELIPGLPEEVAEKCLLHLPFLYHRLFRTVSSTWNRFL
TDSPAKPLLFTPAEGAGAGAGSAAMGSLSLSLPFLFAFAFDPVSRRLQCQALDPFSRRWL
LLPPVPGGAAAGSFAVVGLPRRGEIYVIGGVEEGSDKAVTSVAVYSAARNGWEEAAAMRT
PRGYMAAGEVGGRVVVAGEDGEAEVFDPDAGRWSPAAPRRGAAVAWYDAAAAGGKLYVTE
GWAWPFERAPRGAVYDSATDSWCEMARGMREGWTGSCAVAGGRMYIVAEYGEWRLKQYDE
ARDEWRMVAGSGVPPEVRRPHVVAGEIGEVAGGRRRIYVVGAGLDVAVGTVSASDTAAAP
GVHGVEEEVVEWEVVKGPTEFVGLAPCNAQVLYA*

Other information
Ka divergence:-0.0943633KaKs divergence:-0.290323
GC content 1 (%):74GC content 2 (%):72GC content divergence:-0.014
Length 1 (bp):1158Length 2 (bp):1185Length divergence:0.012
MFE 1 (kcal):-679.5MFE 2 (kcal):-657.3MFE divergence-0.017