Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G151564-GRMZM2G438722
Species:maize
Duplication type:WGD
Function (paralog1):calcium ion binding protein
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.9729885365002
Log2 mRNA fold difference:-1.6306058138435
Log2 TE fold difference:-0.24750753544223
Sequences
Protein sequence

MALSASAASAGRGSRAEKVRRIFERFDTNGDGGLDRNEMAALVVAVNPRVKFSEDQISAI
LDEVFHTYGEFILPDGRGLSLLGLLRTYDDGAGDVDRDFLALSLPAVDSDASSPDIAAGD
AAAHSSPPSGAAAAASLLDDHAKPLGAGGAAPSVSSRAAVAAPAWATSPNHGIAFDSSWG
LLDDLEILVKRLRSKQLRKGSIDGAGNNNFDSFSEAGWSREISGAADSASTAAPWDETSR
DYLTFVKELAVLRTRADASRSREEAFDNHMVIGRALSEHRLFRDALASFRRACELQPTDV
RPHFRAGNCLYALGRHAEAKEEYLLALEAAEAGGSQSADILPQIHVNLGIAMEAEGMVLG
ACEHYREAAILCPSHARALKLLGSALFGVGEYRAAEKALEEAIFLKEDYADAHCDLGSAL
HAVGEDDRAIQEFQTAIDLKPGHVDALYNLGGLNMDAGRFVRAAEMYTRVLSIRPNHWRA
QLNKAVALLGQGESEEAKKALKDAFKMTQRVEVYDAISHLKTLQKKKPKPSKGKDDGQGE
QAYVVVEASKFKRVGRKTTLRQDLANALDIRAFERMTKLGHCDVELLRKEMNETDVPISY
SGTGIPEKSIRKAALEVILRRLLSFLKPDTFQGAIKAINERILSVLDASGSGRVDLGMFF
ATIAPICSGPVDMRKRIVFDALLWRPASEGSNGQIRRSDALTYIKLLRAVYIPTHGASDM
LEMHGESDPTMVSYTEFLEMFNDPDWGFGILSTLVKLEESDHIRHGRHTCSICLYPIIGS
RFKETKHSFSLCNRCYSEGKVPSAFKLEEYRFKEYGNESEALIDKCMCFNLHSKKLEADA
*

MALSASAASTGRGSRAEKVRRIFERFDTNGDGGLDRNEMAALVVAVNPRVKFSEDQISAI
LDEVFRTYAEFILPDGSGLSLSGLLRTYNDGAGDVDRDFVALSLPTVHSDASSPDIAAGD
AAAHSSPPSASAASLLDDHAMPLGGGGVPTPATASSRATAAAPAWAGSPNHGIAFDSSWG
LLDDLEILVKRLRSKQVRKGSIDGSGGAGNSNFDSFSEAGWSREISGAADSASTSAPWDE
TSRDYLTFVKELAVLRTRADASRSREEAFDNHMIIGRALSEHRLFRDALASFRRACELQP
TDVRPHFRAGNCLYGLGRYAEAKEEYLLALEAAEAGGSQSADILPQIHVNLGIAMEAEGM
VLGACEHYREAAILCPSHARALKLLGSALFGVGEYRAAEKALEEAIFLKEDYADAHCDLG
SALHAVGEDDRAIQEFQTAIDLKPGHVDALYNLGGLNMDAGRFVRAAEMYTRVLSIRPNH
WRAQLNKAVALLGQGESEEAKKALKEAFKMTQRVEVYDAISHLKTLQKKKLKPSKGKNDG
QGEQTYVIVEASKFKRVGRKTTLRQDLANALDIRAFERMTKLGHCDVELLRKEMNETDVP
VSYSGTGIPEKSIRKAALEVILRRLLSFLKPDTFQGAIKAINERILSVLDAPGSGRVDLG
MFFAIIAPICSGPVDRRKRIVFDALLWRPASEGSNGQIRRSDALTYVKLLRAVYIPTHGA
SDMLEMHGESDPTMVSYTEFLEMFNDPDWGFGILSTLVKLEESDHIRHGSHTCSICRYPI
IGSRFKETKHSFSLCNRCYSEGKVPSAFKLEEYRFKEYGNESEALIDKCMCFNLHSKKLE
TDA*

www.000webhost.com

Other information
Ka divergence:0.393707KaKs divergence:0.207591
GC content 1 (%):58GC content 2 (%):58GC content divergence:0
Length 1 (bp):2523Length 2 (bp):2532Length divergence:0.002
MFE 1 (kcal):-1032.85MFE 2 (kcal):-1046.5MFE divergence0.007