Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G151576-GRMZM2G141596
Species:maize
Duplication type:WGD
Function (paralog1):CONSTANS interacting protein 4
Function (paralog2):LOC100282576

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MFCIPNYHFAICHPQLPRAHFAVFHSITPSPPVPRPFPLSHLLPPHLAMAFFSHHHLQQP
HPQQAPPPNQQQPVLPSFRNALPVPVDGQIPAPLTFFNPPPAFPEQPAQTTLVDAVGLTA
AAGLGWRQPREQELLGENSQMSSIDFLQTGSAVSTGLALSLEDRRHGGGGAGNSSGDSPL
LLLPMLDDDISREVQRLDADMDRFIKAQSERLRQSILEKVQAKQFEALASVEDKIFRKIR
DKEAEVETINKRNSELEDQIKHLGVEVGAWQQRAKYNESLINALKYNLEQVCAHQSKDFK
EGCGDSEVDDTASCPYGGAVNLQLMPKENRQPKNLTACRVCKSSEACMLLLPCRHLCLCK
ECESKLSICPLCQSSKILGMEIYYA*

MAFFSHHHLQQPHAQQPVLPSFRNALPVPVDGQIPAPLTFFNPPPAFPEQPAQAPLVDAV
GLTAAAGLGWRQPREQELLGENSQMSSIDFLQTGSAVSTGLALSLEDRRHVGGGAGNSSG
DSPLLLLPMLDDDISREVQRLDADMDRFIKAQSERLRQSILEKVQAKQFEALASVEDKIL
RKIRDKEAEVETINKRNSELEDQIKHLGVEVGAWQHRAKYNESMINALKYNLEQVCAHQS
KDFKEGCGDSEVDDTASCRDGGAINFQLTPKENRQPKDLTACRVCKSSEASMLLLPCRHL
CLCKECESKLSFCPLCQSSKILGMEIYYA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):56GC content 2 (%):55GC content divergence:-0.009
Length 1 (bp):1158Length 2 (bp):990Length divergence:-0.078
MFE 1 (kcal):-433.8MFE 2 (kcal):-387.7MFE divergence-0.056