Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G151649-GRMZM2G090493
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382031
Function (paralog2):exodeoxyribonuclease V

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MESDASTSPRRRSTSCYSDSGDSSCSEPFSECGSDDLSFTPAAAAGIHRLLLSCAAEASE
DAISSLVAELECPSQSLDSLRRAAMELRLLAKHNPDNRVRIAAAGGVRPLVRLLSHADPL
LQEHGVTALLNLSICDENKATIVEAGAIRPLVHALKSAASPAARENAACALLRLSQLDGA
SAAAIGRAGAIPLLVSLLETGGARGKKDAATALYALCSGARENRQRAVETGAVRPLLDLM
ADPESGMVDKAAYVLHSLVSSGEGRAAAVEEGGIPVLVEMVEVGTSRQKEIATLSLLQIC
EDNAVYRTMVAREGAIPPLVALSQSSSARPKLKTKAESLIEMLRQPRSPSLRTRPAAVVA
AE*

MESDASTSPRRRSTSCYSDSGDSSCSEPFSECGSDDLSFTPAAGIHRLLLSCASEASEDA
ISSLVAELERPSPSLDSLRRAAMELRLLAKHNPDNRVRIAAAGGVRPLVRLLAHADPLLQ
EHGVTALLNLSLCDENKAAIIEAGAIRPLVRALKSAASPAARENAACALLRLSQLDGASA
AAIGRAGALPLLVSLLETGGARGKKDAATALYALCSGARENRQRAVEAGAVRPLLDLMAD
PESGMVDKAAYVLHSLLGSGDGRAAAVEEGGIPVLVEMVEVGTSRQKEIATLCLLQICED
NAVYRTMVAREGAIPPLVALSQSSSARTKLKTKAESLVEMLRQPRSPSLRARPAAVVAAE
*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):73GC content 2 (%):74GC content divergence:0.007
Length 1 (bp):1089Length 2 (bp):1083Length divergence:-0.003
MFE 1 (kcal):-594.7MFE 2 (kcal):-613.75MFE divergence0.016