Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G151763-GRMZM5G812272
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383722
Function (paralog2):hypothetical protein LOC100279449

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.90733000077368
Log2 mRNA fold difference:1.2982710729869
Log2 TE fold difference:-0.46018701549279
Sequences
Protein sequence

MSSRDLYFHDELASLFAQRPAPAGEAMMTHQHQQQQQAPASWFADYLHAGAPGMGMDYDL
LCRALDLPLPGDDVVKREEELLLVDTGGDGGGFAAPTPTPSGGGTAPVTPNTTSSMSSSS
SEAAGGAAGGGGGREEDSPQGRCKKEEGDGEESKALDKGEEDADKGKKGSAAAGKGKGKG
EKRQRQPRFAFLTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCPVKKRVERS
SQDPAVVITTYEGKHTHPIPVTLRGSTHILAAQLHHHHNHHLGAFPTPLPQTGAAPFGRA
AGGGVIDMLGLLPPRNHGMSGGPMSAVAGAATTTAATITTTSTTPSYPPSLQMQHFMAQD
FGLLQDIMLPSFGGGGGNIQP*

MSSGDFHYHDELAALFAQRPAPAGEMTMALQQQAPAASWFADYLHAGAPGMGMDMDYDLL
CRALDLPVPGDEDGVVKRELLLVADTGGGGGGFAAPLTPNTTSSMSSSSSEAAGAAAGGG
GGGSFGAAEEESQSLGRCKKEDDGDGEESKDKEAMKGEEDDADTGKKGSAAGKGKGKGEK
RQRQPRIAFMTKSEVDHLEDGYRWRKYGQKAVKNSPYPRSYYRCTTQRCPVKKRVERSHQ
DPAVVITTYEGKHTHPIPSTLRGSSTHLLAAQLHHHHHHNIVGAFPPPPPPPQTMCLPFV
GRTGDGGGVIDMLGLCLPPRNHAAVPPAATGLAPSPCCMSGPVGTVAGATTTTAPTTTTV
TTTTTSSPPPPPSLQTMQHFMAQDDFGLLQDMLPSSSSSLSFVVHSNGSNVQLP*

Other information
Ka divergence:0.0929813KaKs divergence:0.208931
GC content 1 (%):69GC content 2 (%):69GC content divergence:0
Length 1 (bp):1146Length 2 (bp):1245Length divergence:0.041
MFE 1 (kcal):-565.8MFE 2 (kcal):-631.2MFE divergence0.055