Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G151873-GRMZM2G165209
Species:maize
Duplication type:WGD
Function (paralog1):myosin-like protein
Function (paralog2):hypothetical protein LOC100272540

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.60234104387622
Log2 mRNA fold difference:0.96895374197927
Log2 TE fold difference:-0.39747927116679
Sequences
Protein sequence

MAARRGPHVIKLHDPNPPLLGRAPGAAPAAVPASSRDEGLLAQHLRASAAHPAFALIEER
LAARDQDIQELLVDNQRFAATHVALQQQLIAAQHELRAVSVAATRARAEREGEVRSLADQ
AAHMEAEARAIAAARAEIDQVHADVQVLAAARTDLVNRLQVLREKLAHKKAEASKTDSVR
PQIETMRREIQNGRAAVDFEKKAHSDNLEQSKAMEKNMIAVASEIERLRGELANAEKGAT
AVNPAAAVGNSGYAAPYGNSASTYTGMYGNPDATYTAQAYPDAYSTNQGHMHTVANPHYM
SQPVPYGQYESQHTNVQR*

MAARRGPHVIKLHDPNPPLLGRAPGTAPAAIPAPSRDEGILAQHPRAAPSSASASHPAFA
LIEERLVARDQDIQELLVDNQRFAATHVALQQQLIAAQHELRAVSVAATRARAEREVEVR
ALADQAAHIEAEARAVAAARAEVDQVHADVQVLVAARTDLVNRLQGLREKLAHKKAEASK
TDSVRAQIETMRREIQKGRAAVDFEKKAHSDNLEQSKAMEKNMIAVASEIERLRGELANA
EKGATAVNPAAAVGNSGYVAAYGNSEPTYTAMYGNPDATYTAQAYPDAYNTNQAHMHAGA
SSYYTSQPFSYGQYESQHTNIQR*

Other information
Ka divergence:0.093721KaKs divergence:0.127214
GC content 1 (%):62GC content 2 (%):62GC content divergence:0
Length 1 (bp):957Length 2 (bp):972Length divergence:0.008
MFE 1 (kcal):-396.42MFE 2 (kcal):-385.42MFE divergence-0.014