Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G151993-GRMZM2G152025
Species:maize
Duplication type:TD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100273575

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.1893234863811
Log2 mRNA fold difference:1.8900584859742
Log2 TE fold difference:-0.69058237522821
Sequences
Protein sequence

GFPPQPLAPHLLFSSALNSSLLLPAVVHHHLRPGPGHSSPPPVRPPPLRAPPDASLRSCW
PPWPPSWPRPSSPSRPPRPSSPRRRRRPPVPPRTSARGPCGPLSGRRRPPSRRPPRPRPR
RSPRSRRRASSPTYTSPRSRTSAGASSTPRSPATTRRGRRGTWSSAPKALLCLREVSESG
GKKKRKEKMMTVSTSCYMCRFLVRAPPLKSRSAVRCPSAAPPGASGATSTSKTQDPVENQ
KLCAYLVEKAVNRLPPGAENILGIFDLRGFRVENGDLQFLKFLMDVFYYYYPKRLGQVLF
VDAPFVFQPMWQVVKPLLKSYASLVRFCDAETVRKEYFKEETVPPDFRD*

MVFSTEGPSLPARGLRIRGEKKRKEKMMTVSTSCYMCRSLVRAPPLKSRSAVRCPSAAPP
GASGATSTSKLVLEVKERLAREHPGLPTGRNGRDDDDMVLWFLKDRKFSVDEAVSKLTKA
IKWRQDFGVAELSEESVKSLYQTGKAYVHDSLDIYGRPVLIVVAAKHFPSTQDPVGNQKL
CAYLVEKAVSRLPPGVENILGIFDLRGFRVENGDLQFLKFLMDVFYYYYPKRLGQVLFVD
APFVFQPMWQVVKPLLKSYASLVRFCDAETVRKEYFKEEIVPPDFRD*

Other information
Ka divergence:-1KaKs divergence:-0.999821
GC content 1 (%):58GC content 2 (%):50GC content divergence:-0.074
Length 1 (bp):1050Length 2 (bp):864Length divergence:-0.097
MFE 1 (kcal):-393.56MFE 2 (kcal):-289.45MFE divergence-0.152