Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G152390-GRMZM2G178279
Species:maize
Duplication type:WGD
Function (paralog1):type I inositol-1,4,5-trisphosphate 5-phosphatase CVP2
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.0535271925325
Log2 mRNA fold difference:-1.6466167264114
Log2 TE fold difference:0.71731352305735
Sequences
Protein sequence

MLENQKQAEVLWPRLVANKLFRKTSGSHAFVADFPAADDDDDIVFGTEADGGGGCSPDAD
ASRCVKRARPHERNKTLKYKLFASTWNVGGVAPPDGLDLSDWLDGGDDDGPYDMYVLGFQ
EVVPLRARNVLGADKKRVGMRWIELTRAALNRSHSQRSRGGGGGKQKVHPVRDGGGGELG
REYRCVVSKQMVGILLTVWVRSDLRRFVRRPSVSCVGCGVMGCLGNKGGVSVRFWLHDTS
FCFVCCHLASGGREGDEAHRNANATEILSRTTFPRGHALNLPLPQNILDHDRVILLGDLN
YRISLPEAKTRLLVERQDWKTLLENDQLRAEVCRGGAFQGWSEGPIGFSPTYKYHPNSDA
YYGCATAARGRNKRRAPAWCDRVLWRGAGLAQTRYDRCESRLSDHRPVRAVFAVEVDAPG
DLNSLRSFFMSERFDRDQMLLRKDDVNSARFGDTL*

MLENQKQAEVLWPRLVANKLFRKTSGSHAFVADFPATDGDGDVVFGGTEFDGGGCSPDPD
DADASRCVKRARPQPQPQERNKKTLKYKLFASTWNVGGVAPPDELDLSDWLDGGGGDDDD
GPYDMYVLGFQEVVPLRARNVLGADKKRVGMRWIELTRAALNRSSSSHAQRGGGSGGGSG
SGDGGGGGRQKVHPVRDGGGGGGLACRDYRCVVSKQMVGVLLTVWVRSDLRRFVRRASVS
CVGCGVMGCLGNKGAVSVRFWLHETSFCFVCCHLASGGRDGDEAHRNADATEILSRTAFP
RGQALNLPLPHKILDHDRVILLGDLNYRISLPEAKTRLLVERQDWKTLLENDQLRAEVRR
GGAFQGWSEGPIAFSPTYKYCPNSDAYYGCATASATADARRHKRRAPAWCDRILWRGEGI
RQARYGRCESRLSDHRPVRAVFTVEVGAPAPGSNLNSLRSFFMSERFDGAGSRSPAADQL
LRRDDDVNSARFSDAL*

Other information
Ka divergence:-0.0146536KaKs divergence:-0.162245
GC content 1 (%):69GC content 2 (%):70GC content divergence:0.007
Length 1 (bp):1368Length 2 (bp):1491Length divergence:0.043
MFE 1 (kcal):-699.1MFE 2 (kcal):-772.71MFE divergence0.05