Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G152419-GRMZM2G062470
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274122
Function (paralog2):hypothetical protein LOC100278535

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MITTHLSPALKHRSPSPLHSTYHSHHHLPVHLPLPLPRRHCHLAKPAAAASPDLLASIES
VASAASVLAAIVLVHESGHFLAAASRGIHVSQFSIGFGPALARFRLGAVECTLRAIPLGG
YVGFPDDDPESGFAPDDPDLLRNRPVPDRLLVVSAGVAANLAFAFLVVYAQALTVGVPVQ
ARLPGVLVPEVLPGSAAARAGLLPGDVILAAPGAAPDPSVPVLVDLMKASPGRKVPLTVF
RAAPGKLEPDPRPVELTVVPDTSADGTGRIGVQLSPNVRVTRVRPENLADATVLAAREFA
LLTVTVFDGLRQTLLNFSQSADKVSGPVAIIAVGAEVARSSADGLFQFAAVINLNLAAIN
LLPLPALDGGTLALILLEAARGGRKIPREVEQGIMSSGILVVLMVGMFLIVRDTLNLDFI
KEML*

MIATHLSPGLKQYRFPSPLHSTSHNHHLPVHLPLPRRHRNFAKPAAAVPDLLASVESVAS
AASVLAAIVLVHESGHFLAAASRGIHVSQFSIGFGPALARFRLGPVEYALRAIPLGGYVG
FPDDDPESGFAPDDPDLLRNRPVPDRLLVVSAGVAANLAFAFLIVYAQALTVGVPVQAQL
PGVLVPEVLPGSAAARAGLLPGDIILAVPGAAPDPSVPVLVDLIKASPSREVPLTVSRAA
PGAVDRRSVELTVVPDTSADGSGRIGVQLSPNVRVTRVRPQNLADATVLAVREFTLLTGT
VFDGLRQTLLNFSQSADKVSGPVAIIAVGAEVARSSADGLFQFAAVINLNLAAINLLPLP
ALDGGTLALILLEAARGGRKIPREVEQGIMSSGILVVLMVGMFLIVRDTLNLDFIKEIL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):69GC content 2 (%):68GC content divergence:-0.007
Length 1 (bp):1275Length 2 (bp):1260Length divergence:-0.006
MFE 1 (kcal):-560.3MFE 2 (kcal):-548.86MFE divergence-0.01