Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G152447-GRMZM2G152477
Species:maize
Duplication type:TD
Function (paralog1):LOC100284727
Function (paralog2):hypothetical protein LOC100272649

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.2791734698487
Log2 mRNA fold difference:0.76246004486122
Log2 TE fold difference:0.52225863763696
Sequences
Protein sequence

MANRSVAMGLALAFVAMTALCCAPGAAELPRLDHPARSDGSLKLLVVGDWGRKGTHNQSR
VADQMGRVGEKLDIDFVISTGDNFYKNGLKGVRDQAFEESFVDIYTAQSLQKPWYSVLGN
HDYRGNALAQLSPVLRKIDDRFICMRSFIVNAELVDFFFVDTTPFQLEYWTHPGKHRYDW
RGVAPRGNYLANLLKDLDVAMKKSTARWKIVVGHHTMRSVSEHRDTEELLELLLPVLKDN
GVDFYINGHDHCLEHISSRDSPLQYFTSGGGSKAWRGVFHPNKDKLRFFYDGQGFMSLQL
NQDQAHFIFYDVFGNILYRWSSRHPQSSTYLDEE*

MAQGSRSAAVPAAASFFALLAVAAPLLLCCAPAAAELARLEHPPKDGGSLSLLVVGDWGR
KGTFNQSRVAHQMGRVGEQLSIDFVISTGDNFYENGLTGTDDEAFEQSFTDIYTAKSLQK
PWYLVLGNHDYRGDALAQLSPVLRKIDSRFICIKSFVVNAEIVEFFFVDTTPFQLKYWTH
PKDDHYDWRGVAPRENYINNLLKDLDGAMKTSTAAWKVAVGHHTMRSVSDHGDTKELLQL
LLPVLQANGVDFYINGHDHCLEHISSRDSPIQYFTSGGGSKAWRGVQNPTEDDLKFFYDG
QGFMSLQLDRSQAKFTFYDVDGKALYSYTRSSLMETGHHLQASGYVNEE*

Other information
Ka divergence:0.00620908KaKs divergence:-0.0163279
GC content 1 (%):54GC content 2 (%):60GC content divergence:0.053
Length 1 (bp):1005Length 2 (bp):1050Length divergence:0.022
MFE 1 (kcal):-360.2MFE 2 (kcal):-413.98MFE divergence0.069