Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G152552-GRMZM5G820996
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):60S ribosomal protein L34

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.29991822394906
Log2 mRNA fold difference:0.80224424358746
Log2 TE fold difference:-0.49826734602582
Sequences
Protein sequence

MVQRLTYRKRHSYATKSNQTRVVKTPGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPA
EYKRSRLPRSRRTVNRPYGGVLSGIAVRERIIRAFLVEEQKIVKKVLKIQKTKDKTAAK*

MNLAVRSLLPPKPTISTLGAAAHLSPLLALPSPQAPTHAASLGVYRRRRRDGAAPHLPKA
SQLRDKIQSDPGREDPRFAPSGGKLVYQYTKKRASGPKCPVTGKKIQGIPHLRPAEYKRS
RLSRNRRTVNRPYGGVLSGIAVRERIIRAFLVEEQKIVKKVLKIQKTKDKTAAK*

Other information
Ka divergence:0.81778KaKs divergence:0.524496
GC content 1 (%):53GC content 2 (%):56GC content divergence:0.028
Length 1 (bp):360Length 2 (bp):525Length divergence:0.186
MFE 1 (kcal):-124.21MFE 2 (kcal):-177.5MFE divergence0.177