Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G152663-GRMZM2G165426
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):CONSTANS interacting protein 6 (LOC100280720), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.88609833891591
Log2 mRNA fold difference:-1.1548711349709
Log2 TE fold difference:0.27567027167351
Sequences
Protein sequence

MFGDSDGSKDASAAAPGSNSNPPEPPFPNRELTLSSYLCDKAPPAAAAGPSSPPNPEAAA
PADDAAASAKLCVERDFLHLSAPKRGDPPGDDSSVVGGKKPRLDSLQLSLSLSTDAPAPP
PASQQPSSSLPPPQLASLLPVDGDLRGATAAAAAAVPATPVAPPPRRTYSANTGRTRSIN
SDDMSYSYSVFSHNPSCSLTHNSTDIYAAGEGTNGSVHSRFNFRPMGDGSVAFAPAQLKE
GTSSFFPTELPARMAAALSAGASFDASHGGMHSSRPHRILREIVSDPVPAMAQALQDFPS
ETLEVLRETVRGMVDAPEKRDELSSLQRKLERRSDLTAEVLGRANKTQLEILVAIKTGMA
TFVTGKGRVSSSELVEMFLMTRCRNLNCKSAVPVDDCECKICSTKKGFCSACMCPVCQKF
DCAANTCSWVGCDVCSHWCHAACALEKNLIRPGPTLKGAMGTTEMQFQCLGCNHASEMFG
FVKEVFNCCAQNWSAETQIKELDFVRKIFAASEDFEGKGLHAKAEEVLSMLVKKLISPPD
ATNTMLQFFKYGVTDCSVTGSKSKGILAAQTSKSTDMLHLQTPTITPPKSPFNFKPSTSI
LDSQIDVLKASPKPLPIEPHFSSSSKDDDSSSLETIVKCKEAEAKLFQKLADDARKEVDS
YRQIVRTKTQKLEEEYATKVAKLCFQETEEKRRKKVEELKTLENSHYDYHKMKLRMQTEI
QGLLERMEATKKMWV*

MFGDSDGSKDASAAAPGSNPPEPPFPSRELTLSSYLCDKAPPAAAGPSSPPNPEAAAGPA
EDAAASAKLCVERDFLHLTAPKRGDPPGDDSSVVGGKKPRLESLQLSLSLSTDAPAPPPA
SQQPSSSLLPPSQLASFLPVDGDLRCGSAAPAAAAAVPAAPAPPPRRTYSANTGRTRSIN
SDDMSYSYSVFSHNPSCSLTHNSTDIYAAGEGTNGSVHSRFNFRPMGDGSVAFAPAQLKE
GTASFFPTELPARAAAALSAGGSFDGSRGGMHSSRPDRILREIVSDSVPAVAQVLQDFPS
ETLEVLRETVRSMVDAPEKRDELSSLQRKLERRSDLTAEVLGRANKTQLEILVAIKTGMA
TFVTGKGRVSGSELVEMFLMTRCRNMNCKSAVPVDDCECKICSTKKGFCSACMCPVCQKF
DCAANTCSWVGCDVCSHWCHAACALEKNLIRPGPTLKGAMGTTEMQFQCLGCNHASEMFG
FVKEVFNCCAENWSAETQMKELDFVRKIFAASEDFEGKGLHAKAEEVLSMLVKKTISPSD
ATKTMLQFFKYGVTDYSVTGSKSKGILAAQTSKSTDMLHLQTPTITPPKSSFNFKPSTSI
LDSQINVLKASPKPLSIEPHFSSSSKEDDSSSLETIVKCKEAEAKLFQKLANDARKEVDS
YRQIVRAKTHKLEEEYAAKVAKLCFQETEEKRRKKVEELKVLENSHYDYHKMKLRMQTEI
QGLLERMEATKKMWV*

Other information
Ka divergence:0.0356607KaKs divergence:-0.0418182
GC content 1 (%):60GC content 2 (%):60GC content divergence:0
Length 1 (bp):2208Length 2 (bp):2208Length divergence:0
MFE 1 (kcal):-926.86MFE 2 (kcal):-946.02MFE divergence0.01