Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G152703-GRMZM2G079316
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277102
Function (paralog2):hypothetical protein LOC100276390

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEKAGQQRHVIGGGGKKAPALGLQKQNSWSPDIERDEAWERRRRGMRRGGTALRRARSVT
DDDLDELRGCIDLGFGFEPAHAAACACACACAGRNRLLETLPALDLYYAVHGGAAEAPPC
SCGAASEASSSEESPLGSPMSILSPGDTPETVKMRLKQWAQVVALSMLSRH*

MDKAWQRNLHLIGGGGGGGEKKACPAAAPALGLQKHKSWSPDIERDEVWERRRRDMRRGG
TALRRARSVTDDDLAELRGCIDLGFGFEPAESVCAACGCAVRNRLLDTLPALDLYYAVHG
GGGACEAEGPKCSCGAASEASSDESPLGSPMSILSPGDPPETVKMRLKQWAQSNLGPALM
DWRRSDGSSAVRTRGVRRLSASDVCAVPGCSAAGSRRLEDRDRFHEHRQMPSVPSMVLPC
ATRGPLDGQPF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):73GC content 2 (%):69GC content divergence:-0.028
Length 1 (bp):516Length 2 (bp):756Length divergence:0.189
MFE 1 (kcal):-298.8MFE 2 (kcal):-405.1MFE divergence0.151