Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G152891-GRMZM2G029107
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217114
Function (paralog2):hypothetical protein LOC100217114

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
EVDEMIREADVDGDGQINYEEFVKVMMANRHHASAGRH

MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE
EVDEMIREADVDGDGQINYEEFVKVMMAK*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):60GC content 2 (%):58GC content divergence:-0.017
Length 1 (bp):474Length 2 (bp):450Length divergence:-0.026
MFE 1 (kcal):-197.9MFE 2 (kcal):-171.2MFE divergence-0.072